KEGG   Thamnophis sirtalis: 106543031Help
Entry
106543031         CDS       T06107                                 

Gene name
LSP1
Definition
(RefSeq) lymphocyte-specific protein 1
  KO
K14957  lymphocyte-specific protein 1
Organism
tsr  Thamnophis sirtalis
Pathway
tsr04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106543031 (LSP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caldesmon
Motif
Other DBs
NCBI-GeneID: 106543031
NCBI-ProteinID: XP_013914393
LinkDB All DBs
Position
Unknown
AA seq 282 aa AA seqDB search
MTSAILRRNSSKQGLQNLIRLTAQWSVEDEEEAARERRRRERERQLRSQTEDGLSSTSEV
AVQEIRIEGKPPGTLELEEDEGFSDWSQKLEQLKQRSGGEGAQEAHQGECRQAQEAEPIQ
CEESPRSPTRSYEEEEEEDSNLKEAEVMLEQVNLDQEAPIFIRFETRSSNFLKFVSTSTS
EEYPGAELEQQQQLRETLEPGEENQHAEDKLQENITEENMPEEEEEKQEEKKRRLYEPEE
VPEKRQRTPSTSSQEDEYQTPLSPTLKIIDRTESLNRSVQKR
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtgcgatcttgaggcggaattccagcaaacagggattgcagaatctcataagg
ttgacagctcaatggagtgtggaggatgaggaggaagctgcaagggagcgacgtcgaagg
gaacgtgagagacagctgaggtcccagacagaagatggcctcagcagcacctctgaagtg
gcagtacaagaaatcaggattgaagggaagcctcctggaaccttagaactggaagaagat
gagggctttagtgactggtcccagaaacttgaacagctcaagcaacgatcgggaggagag
ggagcgcaagaagctcaccaaggggaatgcagacaagcccaagaagcagagcctatacag
tgtgaagaaagtcccaggtcaccaacacgctcctacgaagaagaagaagaagaggacagc
aatctgaaggaagcagaagtaatgctggagcaagtcaatctggatcaggaggctcccatc
ttcatccgctttgaaaccagatcatccaatttcctcaagtttgtttctacttcaacttca
gaagagtaccctggagcagagctggagcagcagcaacagcttagggaaaccttggagcct
ggagaagagaatcagcatgctgaggacaagctccaagagaacattacagaagagaatatg
cctgaggaggaggaagaaaaacaagaggagaagaaaagaagactatatgagcctgaagag
gtcccagaaaaacgacagaggaccccaagtacatccagtcaggaagacgagtatcaaact
ccgttaagcccaacattaaagatcattgacaggactgaatctctgaaccgatctgtgcag
aaaaggtaa

DBGET integrated database retrieval system