KEGG   Thamnophis sirtalis: 106543499
Entry
106543499         CDS       T06107                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tsr  Thamnophis sirtalis
Pathway
tsr00480  Glutathione metabolism
tsr00980  Metabolism of xenobiotics by cytochrome P450
tsr00982  Drug metabolism - cytochrome P450
tsr00983  Drug metabolism - other enzymes
tsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106543499
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    106543499
   00982 Drug metabolism - cytochrome P450
    106543499
   00983 Drug metabolism - other enzymes
    106543499
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tsr02000]
    106543499
Enzymes [BR:tsr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     106543499
Transporters [BR:tsr02000]
 Other transporters
  Pores ion channels [TC:1]
   106543499
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C Glutaredoxin
Other DBs
NCBI-GeneID: 106543499
NCBI-ProteinID: XP_013915004
LinkDB
Position
Unknown
AA seq 257 aa
MCAAGTIFSLVNRSKMSGEFARSLGKGNLAPGPVPEGIIRLYSMRYCPFAQRTRLILKAK
GINHEIVNINLKNKPEWFFEKNPFGMVPVLETSKGQLIYESPITCEYLDEAYPEKKLYPA
DPYEKAYQKMLLEYFSKVPPITYKYTLAIRNGEDASAPKSEYQEKLLRLEEMLANHKTKF
FGGDSVSMIDYLIWPWFERMEGFQLLECLDHTPGLKCWVDLMKLDPAVQATITDPQIFKG
FVELYYNNNLEACDYGL
NT seq 774 nt   +upstreamnt  +downstreamnt
atgtgcgcagccggtaccattttctctctggtgaaccgaagcaagatgtctggggaattc
gctagaagcttgggaaaaggaaatctagccccagggccagtgcctgaaggaatcattcgt
ctgtacagtatgcgttactgcccttttgcacagagaactcgactcatcctaaaagccaaa
ggaatcaaccatgaaatagttaatatcaatttgaaaaacaaaccagaatggttttttgag
aagaacccatttggaatggtacctgtgctagaaacaagcaagggacagctgatctatgaa
tctccaatcacttgtgaatatttggatgaagcttacccagaaaagaagttgtaccctgcg
gacccttatgaaaaagcatatcagaaaatgctcctggaatatttttctaaggtgcctcca
ataacctacaagtatactctggctatcaggaatggtgaagatgcatcagcaccgaagagt
gaataccaggagaagcttctcaggcttgaagagatgcttgcaaaccacaaaactaagttc
tttggtggagattcagtatccatgattgattatctaatctggccatggtttgaacggatg
gagggcttccagttacttgaatgtttggaccatactccagggttaaaatgctgggttgat
ctgatgaagttagatccagctgttcaggccacaataactgatcctcaaatcttcaagggc
ttcgttgaactgtattacaataataatcttgaggcctgtgattatgggctctga

DBGET integrated database retrieval system