KEGG   Thamnophis sirtalis: 106544693
Entry
106544693         CDS       T06107                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
tsr  Thamnophis sirtalis
Pathway
tsr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106544693 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tsr03000]
    106544693 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:tsr03310]
    106544693 (NR3C1)
Transcription factors [BR:tsr03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    106544693 (NR3C1)
Nuclear receptors [BR:tsr03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   106544693 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 106544693
NCBI-ProteinID: XP_013916515
UniProt: A0A6I9Y891
LinkDB
Position
Unknown
AA seq 760 aa
MEPKESLKSTRGEERGKSAHFHPSFRGGASVKTPVSTLSASSQSDSKQPVLCDLPKGLGS
NVPQPDLSKAVSLSLLYMGETDTKVMGNELGFPQQGPISLSSGETDFRLLEESIASLNKS
SSLIESSKGVASTDVSLEPEFPAMTGRDLTLNQGSLAQGQVDSNSGSLKLFSEDQSTFDI
LQDFDLPPVSPGRETNGSPWRMDPVLDESSLLSPLGGDESFLLEGNEMEDCKPPILPDTK
PNINECEDLLSSSTMQMPQVKTEKEDFIELCTPGVIKQEKIGTTYCQANFSGSSMVGNKT
SAISVHGVSTSGGQVYHYDLNTASVTQQQDKKPVFNAIPSHSASSENWNRCQGSGDDALT
PVGALNFSNRSVFSNGYSSPGVRSDVSSSPSTSSTTTGPPPKLCLVCSDEASGCHYGVLT
CGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKI
KGIQQSSVPAGRDTAENPTNKAIVPATLPQLTPTLVSLLEVIEPEVMFSGYDSTIPDTTW
RIMSTLNMLGGRQVVAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYKQSN
GSLLCFAPDLIINEQRMNLPCMYDQCKRLLMVTNELTRLQVSYEEYLCMKTLLLLSTIPK
EGLRSQALFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHDVVENLLTFCF
QTFLDKSMSIEFPEMLAEIISNQLPKYSNGNIKKLLFHQK
NT seq 2283 nt   +upstreamnt  +downstreamnt
atggagcccaaagaatcgttgaaatccaccagaggggaggaaagagggaaaagtgctcac
tttcatccatcctttaggggtggtgcttctgtcaagactcctgtatctaccctgtctgcc
tcatctcaatctgactccaagcaacctgttctgtgtgacttaccaaaggggttaggaagc
aatgtgccgcagccggatctctccaaagcagtgtcactttcactgctgtatatgggtgaa
accgatacaaaagtaatgggaaatgaacttggatttcctcagcaaggcccaatcagcctc
tcctctggggaaacagattttagactccttgaagaaagcatagcgagcttgaataaatcc
tctagtctgatagaaagctcaaaaggagttgcatctactgatgtttccctagaaccagag
ttcccagctatgactggtcgtgatcttactttaaatcaagggtctttagcacaaggccag
gttgacagtaacagtggcagcttgaagctcttttcagaagaccaaagcacctttgatatt
ttgcaagattttgatttgccaccagtgtctcctggaagagaaacaaatggaagcccttgg
agaatggatcctgttctggatgaaagtagcttgctttcgcctcttggtggggatgagagt
tttcttttggaaggaaatgaaatggaggattgcaagcctcccattttaccagacacaaag
cctaatattaatgaatgtgaggatcttttgtcaagttctacaatgcagatgccgcaagtg
aaaactgaaaaagaagattttattgaattgtgtacccctggagtaataaagcaggagaaa
ataggcacaacttactgccaggctaatttttctgggtcaagtatggttggaaataaaaca
tctgccatttctgttcatggtgttagcacttctggaggacaagtttaccactatgatttg
aacactgcatctgtcactcaacagcaggataagaaaccagttttcaatgccattccatct
cattctgctagttcagaaaattggaataggtgccagggatctggagatgatgcccttaca
ccagtaggggctttgaatttttcaaacagatctgtcttctccaatggatattcaagccct
ggagtaagatctgatgtgagcagttcaccatctacctcttcaacaactacgggaccacct
cccaagctttgccttgtttgctcagatgaggcttctgggtgtcattatggtgtcctgaca
tgtggcagctgcaaagtattcttcaaaagagctgtggaaggacagcacaattatctctgt
gctggaagaaatgattgtattatcgataaaattcggagaaagaattgccctgcttgtcgc
taccggaaatgtcttcaagctgggatgaaccttgaagcacgaaagacaaaaaagaaaata
aaaggaattcaacaatccagcgtgcctgcaggaagggatactgctgaaaatcccacaaac
aaagctatagttcctgccacactgccacagctgactcctacccttgtttccctactggaa
gtcattgagccagaagtgatgttttcaggctatgacagcacaataccagacacaacttgg
cgcataatgtcaactctcaatatgttaggtggaagacaagtggttgctgcagtgaaatgg
gcaaaggcaataccaggcttcagaaacttgcatctagatgaccagatgactctactgcag
tattcctggatgtttctgatggcttttgctctaggatggagatcatataaacagtctaat
ggaagtctactgtgttttgctccagatttgatcattaatgagcagagaatgaatctacca
tgcatgtatgatcaatgcaaacgtttactgatggttactaatgagttaacccggcttcag
gtttcctatgaagaatatctctgcatgaaaacattgctccttctctctacaattcctaag
gagggcttgaggagtcaggctctctttgatgaaattcgtatgacatacatcaaagagttg
gggaaagccattgtgaagagagaaggaaactctagtcagaactggcaacgattttaccaa
ctgacgaaacttttggactccatgcatgatgtggttgagaatcttctaaccttttgcttc
caaacgtttttggataaatccatgagtattgagtttccagaaatgttggcagaaatcatc
agcaatcagttaccaaaatattcaaatgggaatattaagaagctcctatttcatcagaag
tga

DBGET integrated database retrieval system