KEGG   Thamnophis sirtalis: 106546690
Entry
106546690         CDS       T06107                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
tsr  Thamnophis sirtalis
Pathway
tsr04068  FoxO signaling pathway
tsr04110  Cell cycle
tsr04115  p53 signaling pathway
tsr04218  Cellular senescence
tsr04310  Wnt signaling pathway
tsr04340  Hedgehog signaling pathway
tsr04371  Apelin signaling pathway
tsr04510  Focal adhesion
tsr04530  Tight junction
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106546690 (CCND1)
   04340 Hedgehog signaling pathway
    106546690 (CCND1)
   04371 Apelin signaling pathway
    106546690 (CCND1)
   04068 FoxO signaling pathway
    106546690 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106546690 (CCND1)
   04115 p53 signaling pathway
    106546690 (CCND1)
   04218 Cellular senescence
    106546690 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106546690 (CCND1)
   04530 Tight junction
    106546690 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 106546690
NCBI-ProteinID: XP_013919099
UniProt: A0A6I9XSQ6
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLLCCEVETIRRAYQDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRYLSFEPIKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPNELLQMELLLVNKLKWNLAATTPHDFIEHFLNKMPVAEDSKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGNTNSFLSYQCLTPFLSKVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEEEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctctgctgtgaagtcgagaccatccggagagcctaccaagatgcc
aacctcctcaatgacagggtcttgcagactatgctgaaagcggaggagacttgttcgccc
tccgtctcctacttcaagtgcgtgcaaaaggagatcttaccatatatgaggaaaatagtg
gccacttggatgttggaggtttgtgaggaacagaaatgtgaagaagaagttttcccattg
gcaatgaattatttggaccgatacctctcttttgaacccatcaagaaaagccgcttgcaa
ctactcggagctacttgtatgttcgtggcttcaaaaatgaaggaaactattcctctaaca
gcagaaaaactgtgtatttacactgataactccattagacctaatgaattactgcaaatg
gaactgcttctggtgaataagctgaaatggaatctggctgccacaactcctcatgatttt
attgaacattttctaaataaaatgcctgtggctgaggacagcaagcagatcatccgtaaa
cacgcccagacttttgtggctctctgtgcaacagatgttaaatttatttcaaacccacct
tccatgattgcagccggtagtgtggtagcagctgtgcaaggtcttcaccttggaaacact
aattcttttctctcttatcaatgcctcacacctttcctatcaaaagttatcaaatgtgat
ccggattgtttacgagcctgccaagaacagattgaatctctccttgaatctagtcttcgc
caggcacaacaacacaacgtatcttcagaaacaaagactgttgaagaggaagctgatctt
tcctgcacacccactgatgttagagatgtgaatatttaa

DBGET integrated database retrieval system