KEGG   Thamnophis sirtalis: 106546721
Entry
106546721         CDS       T06107                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
tsr  Thamnophis sirtalis
Pathway
tsr04141  Protein processing in endoplasmic reticulum
tsr04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106546721 (ATF6B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106546721 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tsr03000]
    106546721 (ATF6B)
Transcription factors [BR:tsr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    106546721 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf YabA
Other DBs
NCBI-GeneID: 106546721
NCBI-ProteinID: XP_013919144
UniProt: A0A6I9XSU9
LinkDB
Position
Unknown
AA seq 644 aa
MAALASELLLLSDSSRFRADNLLSSEDWDAGLYSCLDNDGNVAAELFPCLEHSIMDSNGT
CSAFGDGFDLDMETMPPDPPWDPLQESLFPELQVKSEPVSPASSHCSDSSVASSDSSAAG
SSSAELSEQVLGPGDVIGVKTEHPPTPPCMFGDVLLPPFGTVHINVVPASETGKPAAPNK
TESILSRKPPIQPKPVVVTTVPGQTAASSSKTILLQPVPVTQSQTVNPGISVPAQSVVIS
QSELLHLPVSGLIKVQSPVKEVLSPKPAPSVPKPETKTIIPAPAQIGPCNQEIDIKVLKR
QQRMIKNRESACQSRRKKKEYLQGLESRLREALAENERLRRENAILRRRLDGVLDENTDL
KFGSGNRKVICVMVVLLFIAFNFGPVSITEHKVADVSQPKQEPESGPGQRHLLSITQEAL
EMPEEEQEEQQEETLARPGKAQFRNLSAPFSEMKDLMLRDLDELFLASDCRQFNRTESLR
LADELSGWVRRHQINRRKPSQARKTTQGSQEKPPKKPPSPSHYVPASPPKYPQGDSLRQL
QVYQHPDHTEHDFMDAIDRREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAMNG
KTKQNFSGEAGLLLPSFQKVAACQHLFFPFLQRASTAPPWATKS
NT seq 1935 nt   +upstreamnt  +downstreamnt
atggcggcgctggcttcggagttgctgcttttgagcgattcaagccgcttccgagcagac
aacctgctgagcagcgaggactgggatgcaggtctttacagctgcttggataatgatgga
aatgtggcagctgaacttttcccttgtcttgaacacagcattatggacagtaatggtacc
tgttctgcgttcggtgatgggtttgatctggatatggaaactatgcctccagacccacct
tgggatcctttgcaagaatctctattcccagagttgcaagtaaagtctgagccggtctcc
cctgcgtcatctcattgctccgattcatcggtagcctcctccgattcctctgcggcaggc
tcctcttctgccgaactctccgagcaggtccttggaccaggtgacgtgattggagtgaag
acagagcatcctccaacccctccgtgcatgtttggagatgtccttttacctccctttgga
acggtacacatcaatgtagtcccagcttccgagacagggaaaccagcagctcccaataaa
acagagagcatccttagtcggaaaccccccattcaaccaaagcctgtcgtggtgaccact
gtcccaggacagacagccgcctcttccagtaagaccatcttgttgcagccagtacctgta
acccaatcacagaccgtcaaccctggaatctcagttccagcacagagtgttgtgatttcc
caatctgagctgctgcatctcccagtgtccggtttgatcaaggttcagtctccggtgaag
gaagttctctcacctaaaccagccccttcagtccccaagccagaaactaaaacgatcatc
cctgcaccagcacaaataggaccctgcaaccaagagattgatatcaaggttctgaaaagg
cagcagcggatgataaaaaaccgtgaatcggcttgtcagtcccgccggaaaaagaaggaa
tacctccaaggattggaatcccggctgcgagaggcccttgcggagaatgagaggctacgg
cgggagaatgctattcttcggcgacggctagacggtgtcctggatgagaacaccgacctg
aagtttggctccgggaaccgaaaagtgatctgtgtcatggttgtgctgctcttcatagcc
ttcaattttgggcctgtcagcatcaccgagcacaaagttgcagacgtgtctcagcccaag
caggaaccggagtctggcccaggccagaggcatcttctaagcattacgcaggaagctctt
gaaatgccagaagaggagcaggaagaacagcaagaggagaccctggcaaggccaggcaag
gcccaattccggaacctgtcagctcccttctcagagatgaaggacctcatgttgagggac
ctggacgagctgttcctcgcttcagattgccgccagttcaatcgcactgaatcgctccgg
ttggcagatgagcttagcggctgggtccgacgacaccagatcaaccggaggaaaccttca
caagctcgcaaaacaactcagggcagccaggagaagccgccaaagaagccgccaagccct
tctcactatgttccagccagtccccccaaatacccccagggggattctctgagacagtta
caggtgtatcagcatcccgatcatacagagcatgacttcatggatgccattgaccgccga
gaggatactttttacgttgtgtccttccgcagggaccacctgctgctgcctgccatcagc
cacaacaagacctctcgccctaaaatgtccctggtgatgccggccatggctatgaatggt
aaaacaaaacaaaacttctcgggagaggctgggctgctgctgccctccttccaaaaggtg
gctgcatgtcagcatctcttttttccttttctccagagagcctctacggctcctccctgg
gctacgaagtcatga

DBGET integrated database retrieval system