KEGG   Thamnophis sirtalis: 106549276Help
Entry
106549276         CDS       T06107                                 

Gene name
SMYD3
Definition
(RefSeq) histone-lysine N-methyltransferase SMYD3
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
tsr  Thamnophis sirtalis
Pathway
tsr00310  Lysine degradation
tsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    106549276 (SMYD3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tsr03036]
    106549276 (SMYD3)
Enzymes [BR:tsr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     106549276 (SMYD3)
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     106549276 (SMYD3)
Chromosome and associated proteins [BR:tsr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106549276 (SMYD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-MYND TPR_12
Motif
Other DBs
NCBI-GeneID: 106549276
NCBI-ProteinID: XP_013922351
LinkDB All DBs
Position
Unknown
AA seq 423 aa AA seqDB search
MEKFASPGKGNGLRLLKAVKPGELLYRAAPFAYIVSKKRLGGVCEHCLRRKEQLLRCSQC
KVARYCGASCQKEAWLDHKRECKCIKDIDPNFPPDSVRLVGRIIFKVLRQSVCPSEELYS
LSDLQSNVDELSEDMKEGLRHLAKTLQLYLTVEIQDVSQLLPALDIFQIFAKVTSNCFSI
SNGEMQDVAVGLYPSMSLLNNSCDPNCVVIFEGPQLHLRSVREMQLGEELTISYTETIMP
TLERQQNLKRQYCFECDCAMCSTQSKDADMLAGDEQAWKEAKEVINAVGAPKSLEEWEQV
LLSCQTLLKRNTSRLPDTNIYQLKLLDLAMDACINLGLWEEALHYGNRTLEPYRFYYPGF
HPLRAIQMMRVAKLQFHQDMFSQALETLKQTYDLMKVTHGIEHSFMQDLMILTEEWEASM
LLK
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtttgcaagcccgggcaaaggcaacggcttgcgcctcttgaaagcggtgaaa
ccgggcgagttgctgtatcgtgcggcgcccttcgcttacattgtcagcaagaagcgcctc
ggaggcgtgtgcgaacattgtctgcgcagaaaggagcagctactcaggtgttctcaatgc
aaagttgcaagatactgtggtgcaagctgtcagaaagaagcctggctggaccataaacgg
gaatgcaaatgtattaaagatattgaccctaattttcctcctgactcagtgaggcttgtt
ggcaggattattttcaaagtattaaggcaatcggtatgcccatctgaagagctgtattct
ctttctgatcttcagtcaaatgttgatgaattgagtgaagacatgaaagagggtcttagg
catcttgctaagactctgcagctgtatttgacggtggaaatccaagatgtttctcagctt
ttgccggccttagatatttttcagatctttgcaaaagtgaccagtaactgtttcagcata
agcaatggagaaatgcaagatgttgctgttggactttatcccagcatgtccttgttgaac
aacagttgtgatcctaattgtgtggtcatctttgagggtccccaactccaccttcggtcc
gttcgggaaatgcaattgggagaagagctcaccatcagttatactgaaactataatgccc
actctggaacgtcagcagaatctgaagcgtcagtattgttttgaatgtgattgtgccatg
tgttccacacaaagcaaggatgctgacatgttggcaggtgatgagcaagcttggaaagaa
gccaaagaagttataaatgcagtaggagcaccaaagtcacttgaagaatgggagcaagtt
ctgttgtcctgtcagacgttactgaagaggaacacctctcgtctcccagacaccaacata
tatcagctaaaattacttgaccttgccatggatgcctgcataaacctgggcctttgggaa
gaagctctgcattatggtaaccgaactttggagccctaccggttttattatcccggcttc
catcctttgagggctatccagatgatgagagtggccaagttgcagttccaccaggacatg
ttctctcaggcccttgaaaccctgaaacagacttacgatcttatgaaagtaacccatggg
atagagcacagcttcatgcaggacctgatgatacttacagaagagtgggaggctagcatg
ctattaaaataa

DBGET integrated database retrieval system