KEGG   Thamnophis sirtalis: 106551302
Entry
106551302         CDS       T06107                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
tsr  Thamnophis sirtalis
Pathway
tsr04010  MAPK signaling pathway
tsr04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106551302 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106551302 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tsr04052]
    106551302 (KITLG)
Cytokines and growth factors [BR:tsr04052]
 Growth factors
  Growth factors (RTK binding)
   106551302 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 106551302
NCBI-ProteinID: XP_013924856
UniProt: A0A6I9YL44
LinkDB
Position
Unknown
AA seq 280 aa
MKKTQTWIITCFYLQLLLLYPLIKACGNPVTDDVNEIAVLVGNLPYDYMIALRYVQKTDT
LPYHCWLHLMVPELLNSLNNLLNKFKEFPDMSNVLSNYSIINKLRRIITDVMDCLPSTTY
NKNYSQHDHPYEEGKFIPEEFFKHFYSTIEAYKIFSKRPERSDCILPSTTEASANDSSTS
VTEPFLLHPVAASSLRNDSSENNSNKAELDFLSKSSNQVLSIALSTLLAFVFGFVLGAIC
WKKRTCRHILKIHQTTQSNINQDDNEISMLQHKDKSLLQV
NT seq 843 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcttttatcttcaattgctcctactttat
cctcttattaaagcctgtgggaatccagtgacagatgatgtaaatgaaattgcagtgctg
gttggaaatcttccatatgattatatgatagctcttagatatgtccagaagacggacaca
ctgccctaccactgttggttgcatttgatggtccctgaattgttaaatagtctaaataat
cttctcaataaatttaaagaatttccagatatgtcaaatgtcttgagtaattattcaatt
atcaataaactaaggaggatcatcactgatgtgatggactgcttaccttctactacatat
aataagaattatagccaacatgatcatccatatgaagaaggtaaatttattccagaagag
ttcttcaagcacttttacagcactattgaggcctacaaaatcttttcaaaaagaccagaa
cgaagtgattgcattcttccctcaacaacagaagcctctgcaaatgattcaagcaccagt
gtcacagagccatttttattacatcctgttgcggccagttcccttaggaatgatagcagt
gaaaataatagcaacaaagcagaattggacttcctcagtaagtctagcaatcaagtattg
agcatagcactttcaacattgttggcttttgtcttcggctttgttttgggagccatatgc
tggaagaaaaggacctgcaggcatattctaaaaattcaccagactacacaatctaacatc
aaccaagatgataatgagataagtatgttgcagcacaaagacaaatcgcttctacaagtg
tag

DBGET integrated database retrieval system