KEGG   Thamnophis sirtalis: 106554232
Entry
106554232         CDS       T06107                                 

Gene name
PTGDR
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
tsr  Thamnophis sirtalis
Pathway
tsr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106554232 (PTGDR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:tsr04030]
    106554232 (PTGDR)
G protein-coupled receptors [BR:tsr04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    106554232 (PTGDR)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 106554232
NCBI-ProteinID: XP_013928331
LinkDB
Position
Unknown
AA seq 307 aa
MAAGNYRCNWTLRLEPGQSVLPGSLLFAAGLLGNVLALWLLWQHHLKAKLQRGQGRPRAS
AFYLLVSTLAATDLLGKCSLSPIVLAAYAHNRSLVDLWPPSAASEASPSQPEEEEIRSPG
SLCQLFAFLMAFFGLASTVLLLAMALECWLSLGQPYFYEHHTSRRWGGLLTGAAAVLCAL
FCALPLLGFGSNVQYCPGTWCFIRMAGVGRLYSVLYATLLGLLVLAVGLCNLGSMRSLYG
MARRQPPRRTHPVDLQDAAAPSRLPSSGRTEELGQLVLLALMTALFTICSLPLIVSSSLE
DEEEGEN
NT seq 924 nt   +upstreamnt  +downstreamnt
atggccgcaggcaactaccggtgcaactggaccctgaggctcgaaccaggtcagtcggtg
cttcccgggtcgctactcttcgcggcggggctgctgggcaacgtgttggcgctgtggctg
ctgtggcagcaccacctgaaagcgaagctgcagcgcggccaggggcgcccgagggcgtcc
gccttctacctgctggtgagcaccctggccgccaccgacctgctgggcaagtgttcgctc
agcccgatcgtgctggccgcctatgcgcacaaccgcagcctcgtcgacctgtggccgccc
tccgcagccagcgaagccagcccgagccagcccgaggaggaagagatccgctcccccggc
agtctgtgccaactcttcgctttcctcatggctttcttcggcttggcgtccaccgtcctg
ctgctggccatggccctggagtgctggctctcgctcggccagccttacttctacgaacac
cacaccagccggcgttggggcgggctgctcaccggcgcggcggccgttctctgcgctctc
ttctgcgccctgccgctcctgggcttcggcagcaacgtccaatactgtccgggcacgtgg
tgcttcattcgcatggccggcgttggacggctctattccgtgctctacgctaccctgctg
ggcttgctggtgctggccgtcggcctgtgcaatctgggcagcatgaggagcctctacggg
atggcgcgccgccagcccccgcgcaggacccacccggtcgacctgcaggacgcagccgcg
ccttccaggctcccttcctccgggcgcaccgaggagctaggccagttggtcctgctggcg
ctcatgaccgcccttttcaccatctgctccctgccgctgatcgtaagtagctctttggag
gacgaggaggagggggagaactaa

DBGET integrated database retrieval system