KEGG   Thamnophis sirtalis: 106555200
Entry
106555200         CDS       T06107                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
tsr  Thamnophis sirtalis
Pathway
tsr00230  Purine metabolism
tsr01100  Metabolic pathways
tsr04020  Calcium signaling pathway
tsr04114  Oocyte meiosis
tsr04261  Adrenergic signaling in cardiomyocytes
tsr04270  Vascular smooth muscle contraction
tsr04371  Apelin signaling pathway
tsr04540  Gap junction
tsr04912  GnRH signaling pathway
tsr04914  Progesterone-mediated oocyte maturation
tsr04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106555200 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106555200 (ADCY3)
   04020 Calcium signaling pathway
    106555200 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    106555200 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    106555200 (ADCY3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106555200 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    106555200 (ADCY3)
   04916 Melanogenesis
    106555200 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106555200 (ADCY3)
   04270 Vascular smooth muscle contraction
    106555200 (ADCY3)
Enzymes [BR:tsr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     106555200 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1053
Other DBs
NCBI-GeneID: 106555200
NCBI-ProteinID: XP_013929459
UniProt: A0A6I9YZI8
LinkDB
Position
Unknown
AA seq 1117 aa
MPRNRAFSEPEYSVEYSADYSVSLPSDPEHGVGRTHEVTVRNSGSCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVIIMCTVVYTSEKLAPTVAASVGLAAQIL
LFILCKYQLLPDRVTRKFMPYILWILIAAQIFCYLGLNFACNHEASDTVGWQAFFVFSFF
ITLPLHLMPIVLISAISCGIHTLVLGVTIAQQKQQQLESIYGITLLWQILSNVAIYLCTI
CVGIMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQESLMLSILPRHVADEMLKDMKK
DASQKELQQFNTMYMYRHENVSVLFADIVGFTQLSSTCSAQELVKLLNELFARFDKLAAK
YHQLRIKILGDCYYCICGLPDYREDHAVCSIMMGLAMVEAISYVREKTKTDVDMRVGVHS
GAVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMNCLKGEFEVEPGDGGS
RCEYLKEKGITTYLIITPKQALKNGINGVKLSVSSSHGNSPQLINTKECNGSINTTCTTP
DEAEESDTRVVNPSFPNPRRRLRLRDLAERVVDASENEQELNKLLNEALLERESVQALKG
KSTYRLTMRFIDPEMETRYSVEKEKQSGAAFSCSCVVLFFTAVVEIFIDPRLVANYVTFV
VGEILLLILTLCSLAAIFPRVFPKKLVSFSTWIDRTRWARNTWAMSAIFILTMADIVDML
SCQQYYTTVNGTVPALLPSGCVENPKYYSYIAVLALIATIMLVQVSHMVKLTLMVTITGA
VGVVNILAWQQIFDEYDQERFQENMISLVPSKYSMTVMILVMMLSFYYFSRHVEKLARVL
FLWKIDVHNQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGVMFA
SIPNFADFYTEESINNGGIECLRFLNEIISDFDALLDDPQFRCITKIKTIGSTYMAASGV
TPDVNSNGYNTVKKEDLSEKERWQHLADLADFALAMKETLMNINYQSFNNFMLRIGMNKG
AVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETHFILKEYGFRFVRRGHIF
VKGKGDLLTYFMKGREKQDSFINGSCVTLPHQVVDSS
NT seq 3354 nt   +upstreamnt  +downstreamnt
atgcctcggaatagggcattctcggagcctgaatactcagtagagtattcggcagactat
tcagtcagcttgccttctgaccctgagcatggggttggccggacccatgaggtgacggtg
aggaactcaggttcttgcctctgtctgccccgttttatgcgactcacgtttgctcctgag
tccctggaaaacctctaccagacctacttccggaggcagcgtcatgagactttgctggtc
ctggtggtctttgcagccctctttgattgctacgttatcatcatgtgcacagtggtgtac
acgtcagagaagctggcaccaactgtggcagcatcagttggcctggctgcccagatcctc
ctctttatcctatgcaagtatcaactcctgcctgatcgtgtcacccggaaattcatgcca
tacattctgtggatactgatagctgctcagatattctgctacttgggcttgaattttgcc
tgcaaccacgaggccagtgacacagttggatggcaggcctttttcgtcttctccttcttc
atcaccctgcccttgcatctcatgcccattgttcttatctcagccatttcttgtggcatc
cacacgcttgtgttaggagtcaccattgcacagcagaagcagcagcagctggagtccatc
tatggaatcaccttgctgtggcagatcttatccaatgttgccatctatctgtgcaccatc
tgtgtgggtatcatgtcttactacatggcagaccgcaagcaccggaaagccttcctagaa
gctcggcaatctctggaagtcaagctcaatcttgaggaacaaagtcagcagcaggaaagt
ttgatgctttcaattttgcccagacatgtagcagatgaaatgctgaaggatatgaagaaa
gatgcaagccaaaaagaattgcagcagttcaataccatgtatatgtaccgccatgaaaat
gtcagtgtcctttttgctgacatcgtaggtttcacgcagctgtcatccacatgcagtgcc
caagaattggtgaaacttttgaacgaactctttgctcgatttgataaactagcagctaaa
taccatcaactgcgtatcaagattctgggtgactgctactactgtatctgtggattgcca
gattaccgtgaggaccatgctgtttgctcaatcatgatgggtcttgctatggtggaagct
atttcctatgtacgagagaagaccaaaaccgatgtggacatgcgtgtgggagtgcacagc
ggcgctgtccttggtggagtcctagggcagaaacgttggcagtatgatgtatggtctacg
gatgtaactgtagccaacaagatggaagcaggaggcatccctgggcgtgtacacatttct
cagagtaccatgaactgcttaaaaggagaatttgaggtggaaccaggagatggtggttca
cggtgtgaatatctaaaggaaaaggggattaccacctacctcataataaccccgaagcag
gcactcaagaatgggatcaatggggtgaagttatccgtctcatcctcccatgggaactca
cctcaattgatcaacaccaaagaatgcaatgggagcattaatacaacctgcacaacccca
gatgaggcagaagaatcggacactagggtagtgaatccttcctttcccaaccctcgaagg
cgtcttcgcttacgggacttagcagagagagtggtggatgcttcagaaaatgagcaggaa
ctcaataaattgcttaatgaggccttgctggagagagaatctgtccaggcgctaaaaggc
aagtctacctatcgcctaaccatgcgtttcattgatcctgagatggagacacgttactct
gtggaaaaagagaagcagagtggggctgccttcagctgttcatgtgtggtcctcttcttt
actgctgtggtggagatcttcattgatccacggctggtagcaaattatgtgacatttgtt
gttggtgaaatccttctgctgatcttgactctgtgttcacttgctgccatctttcccagg
gttttccctaaaaagcttgtgtctttttccacatggattgacagaacccgttgggccagg
aacacctgggccatgtctgccattttcatcctaaccatggctgacattgtagatatgctc
agctgccagcagtattacaccactgtcaatggtacagttccagcactgcttccgagtggt
tgtgtggagaatcccaaatactacagctacatagcagtgttggcactgattgcaactata
atgctggtgcaagtcagccacatggtcaaactcactctgatggtgacaatcacaggggca
gtgggagtggtcaacattctggcctggcaacagatctttgacgaatatgatcaggagcga
ttccaggagaacatgatctcactagttccatcaaaatattccatgacagtgatgatcttg
gtcatgatgctcagtttctactatttctcacgccatgtagaaaagttggctagggtttta
ttcttatggaagattgatgttcataaccagaaggagcgtgtgtatgagatgcggcggtgg
aatgaggctcttgtcaccaacatgctgccagagcatgtggcacgccattttcttggctcc
aagaaacgagatgaggagctgtatagtcagtcttatgatgaaattggtgttatgtttgcc
tctatccccaactttgccgacttctatacagaggaaagtataaataatggtgggattgag
tgccttcgcttcctcaatgaaataatctcagattttgatgcgctcctggatgatccccag
ttccgatgcatcactaaaatcaaaaccattggcagtacatacatggcagcttctggtgtg
acacctgatgtcaacagcaatggttacaacactgttaagaaggaagatctttcagaaaag
gagcgttggcaacatttggcagatcttgcagactttgccttagccatgaaagagaccttg
atgaacattaactatcagtccttcaataacttcatgctgcgaataggcatgaataaagga
gcagtgctagcaggggtgattggtgcccgtaaacctcactatgatatttgggggaacacg
gtgaatgtggcaagccggatggagtccacaggtgtcatgggaaatatacaggtggtggag
gaaactcactttatcctgaaagagtatggcttccgctttgtgcgtcgagggcacattttt
gtcaaaggcaaaggtgacttgctgacatattttatgaaaggacgtgagaagcaagattcc
tttatcaatggttcatgtgtgactttgcctcatcaggtggttgacagttcttga

DBGET integrated database retrieval system