KEGG   Thamnophis sirtalis: 106555338
Entry
106555338         CDS       T06107                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
tsr  Thamnophis sirtalis
Pathway
tsr00220  Arginine biosynthesis
tsr00330  Arginine and proline metabolism
tsr01100  Metabolic pathways
tsr04020  Calcium signaling pathway
tsr04146  Peroxisome
tsr04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    106555338 (NOS2)
   00330 Arginine and proline metabolism
    106555338 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106555338 (NOS2)
   04020 Calcium signaling pathway
    106555338 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106555338 (NOS2)
Enzymes [BR:tsr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     106555338 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 106555338
NCBI-ProteinID: XP_013929644
UniProt: A0A6I9Z024
LinkDB
Position
Unknown
AA seq 760 aa
MELCLQLGWRAKYGCFDVLPLVLQANGQDPELFELPPELILEVSMEHPTYEWFKDLDLKW
YAVPAVSNMLLEVGGLEFTACPFNGWYMGTEIGVRDFCDVRRYNILQKQSITIMDHHSAA
ESFMKYMQNEYRIRGGCPADWVWLVPPISGSITPLFHQEMLNYIISPFYYYQTACEMFDI
RGKHKILLPKEYTCKETWNPKDFRIVYDSRPLEYAVFGLGSSMYPEFCAFARLVHQKLAQ
LGAFPVSPMGEGDELNGQEEAFRNWAILTFQVTCMVDYNLRDLEKETLLLVVTSTFGNGD
APSNGKVDAWKTHTWKDEKHKPKKRKIRFCIWAKAVLFASSLMRRAMAVRIKATVLYATE
TGKSETLARKLGDMFNCAFSTKRISLQERDNEFGVNKRKKRIPELSWHSALFQLSKSGYW
TPYKKFPACSLSQALMHFLDVTSPPSQQLLRSFSQLAEDKSEKERLNLLCHNLEEYNKWK
FYNSPNLLEVLEEFPSIRLSTSFLLSQLPLLKPRYYSISSSQDWDPQELHLTVAVVTYRP
RSKQAFCSETSFGPVFAVILHKIAAGFQLPKDPRKPCILIGPGTGIAPFRSFWQQRHFDL
EKKGIQGRGLILLFGCRHSSLDHLYREEMEEMHRKGILQEIYTAYSREPGSPKVYVQDLL
RNELEAEVYRLLHEEEGHLYVCGDIRMASEVAKTLKEMFAKKLSLTEEEAEDYCFQLKRQ
KRYKEDIFGATFPKENQRTMEEVKTERTIKVLEAQVQLKL
NT seq 2283 nt   +upstreamnt  +downstreamnt
atggagctctgcctccagctgggctggagagccaaatatggctgctttgatgtgcttcca
ctggtcctgcaagccaatggtcaagacccagaattatttgaattgccgccagagctcatc
ctggaggtgtcgatggagcatcccacatatgaatggtttaaagacctggacttgaagtgg
tatgccgttccggctgtgtctaatatgctccttgaagttggtgggttggaatttacagct
tgtccttttaatggctggtacatggggactgagattggcgtacgggacttctgcgacgtc
cggcgctacaatattcttcagaaacaaagcatcactatcatggaccaccattctgctgcc
gaatccttcatgaagtacatgcagaatgaataccggattcgtggggggtgtccggctgat
tgggtttggctggttccccccatctcgggtagcattacccccctcttccatcaggagatg
ttgaattacattatttcacccttttattattatcagactgcctgtgaaatgtttgatatc
cgtggaaagcacaagatcctgttgccaaaagaatatacatgtaaggaaacctggaacccc
aaggattttaggattgtatatgattctcggccattggagtatgctgtcttcggcttgggt
tcaagcatgtatccagaattctgtgcctttgcccgtcttgtgcaccaaaaacttgcccag
ttgggggcatttccagtcagcccaatgggtgaaggagatgaactcaacgggcaagaagaa
gcttttcggaactgggccattcttacatttcaggttacttgtatggtggattacaaccta
agagaccttgagaaggaaactctacttctggtggtcaccagcacttttggaaatggcgat
gcaccaagcaatggcaaagtggatgcctggaaaacacatacctggaaagacgagaaacac
aagccaaagaaaagaaagatcagattctgcatatgggccaaggctgtgttgtttgcgtcc
tcgttgatgcgaagagccatggctgtcaggatcaaagcaacggtgctctatgcaacagaa
acagggaaatcagagactctcgctcgaaagctgggggatatgttcaattgtgccttcagt
accaagcggatatctttacaagaaagggacaatgaatttggagtgaacaagagaaagaaa
aggatacctgagttatcttggcattcagctcttttccagttgagcaagagtggctactgg
actccttacaaaaagtttccagcatgttcactgtcccaagctttgatgcatttccttgat
gtcacctctcctccttcccagcagttgctaagatcattttcccagctggcagaagataaa
agtgagaaggaaaggctgaatctcttgtgtcataatttggaggaatacaacaagtggaaa
ttttacaacagccccaatctcttggaagtcctggaggaattcccatccatcaggctctca
acatccttcttgctctctcagctgcctttactcaagcccagatattactccatcagttct
tcgcaggattgggacccccaggaattgcatttgactgtggctgtggtgacctacagacct
agaagtaagcaggctttctgttctgaaacttcatttggccctgtgtttgcagtgattctt
cataaaattgctgctggattccaacttccaaaagatccaagaaaaccgtgcatcctgatt
ggtcctggtacaggaattgctccttttagaagcttctggcaacaacgacactttgactta
gaaaagaaagggatccaagggaggggtctgatcctgctgttcggctgccggcactcaagc
ctggaccatctctatcgagaggaaatggaggagatgcatcggaaagggattctccaagag
atctacacagcttactccagagagcccgggagccccaaagtttatgtgcaggacctcctt
cggaatgaattggaagcagaagtgtacagacttctccatgaagaagagggacacctgtat
gtctgcggggacatccgcatggccagcgaagtggctaagaccttaaaggagatgtttgca
aagaaactgagtttgaccgaagaggaagcagaggactactgttttcagctgaagaggcag
aaacgatacaaagaggacatttttggagccacgtttccaaaagagaaccaaagaaccatg
gaagaagttaaaactgaaagaaccataaaagttttagaagctcaagtccagctaaaactt
taa

DBGET integrated database retrieval system