KEGG   Thamnophis sirtalis: 106556843
Entry
106556843         CDS       T06107                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
tsr  Thamnophis sirtalis
Pathway
tsr04010  MAPK signaling pathway
tsr04137  Mitophagy - animal
tsr04210  Apoptosis
tsr04218  Cellular senescence
tsr04620  Toll-like receptor signaling pathway
tsr04621  NOD-like receptor signaling pathway
tsr04622  RIG-I-like receptor signaling pathway
tsr04623  Cytosolic DNA-sensing pathway
tsr04625  C-type lectin receptor signaling pathway
tsr04920  Adipocytokine signaling pathway
tsr05132  Salmonella infection
tsr05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106556843 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    106556843 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    106556843 (RELA)
   04218 Cellular senescence
    106556843 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106556843 (RELA)
   04621 NOD-like receptor signaling pathway
    106556843 (RELA)
   04622 RIG-I-like receptor signaling pathway
    106556843 (RELA)
   04623 Cytosolic DNA-sensing pathway
    106556843 (RELA)
   04625 C-type lectin receptor signaling pathway
    106556843 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    106556843 (RELA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106556843 (RELA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106556843 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tsr03000]
    106556843 (RELA)
Transcription factors [BR:tsr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    106556843 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 106556843
NCBI-ProteinID: XP_013931335
UniProt: A0A6I9Z679
LinkDB
Position
Unknown
AA seq 565 aa
MGDPLPQMASALPATTMEDILPLLFPPSWSLHEPAPSSNPMVEIIEQPKQRGMRFRYQCE
GRLAGSIPGERSTDTTKTHPTIKIHNYQGPGKVRISLVTKEAPHRPHPHDLVGKDCKEGY
YEAELSPERSIHSFQNLGIQCVRKRDLEKAVAKRIETGNNPYNVPMEALKGDYDLNAVRL
CFQVWIRDTNTGHLIQLPLVFSQPIYDNRAPNTAELKICRVNRNSGTCLGGDEIFLLCDK
VQKEDIEVRFFKDSWEAKGSFSQADVHRQVAIVFKTPPYADQTIREPVTVQMQLHRPSDK
EVSGSMEFRYLPDEGDFHRIEEKRKRTLGTFKTFVQKTPFAVGTTEAQSPRRMAVPKHGA
PRPTTSTVPGFLGASSHSPMRPIQKPQVMAQPSAGFFVGSSHPTPLPPMATAAASNFSTV
NMEDLSCLGVSSQAPTSSMDTENSIADAFLQLHFEGGDPLVGLLEDTTYNSLDSINTTEF
RQLLNEGPGPAPLPGDTQGTLMTYPESITRLVSQRRAGGESGGNGDGGGTAHSTNNSFLN
GLLGTFTEDSFSSMGDLDLNSLLNS
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgggagaccccctgccccagatggcctctgcgctgcctgcgaccaccatggaagatatt
cttcctttgcttttcccaccgagctggagccttcatgaacccgcccccagcagcaacccc
atggtggaaataatcgagcagcccaaacagcgggggatgcgcttccgttaccagtgcgag
ggccgcctggccggctccatcccgggggaacgcagcaccgacaccaccaagacccacccc
accatcaagattcacaactaccagggtccggggaaggtccgcatttccctggtgaccaaa
gaagccccccatcggcctcacccccatgacctggtgggcaaggactgcaaagaaggctac
tacgaagccgaattgtctcccgagcgctccattcacagcttccagaacctgggaatccag
tgcgtgcggaaacgggatctggaaaaggccgtggccaagcggatcgaaactgggaacaac
ccgtacaacgtaccgatggaggcgctcaaaggagattacgacctgaatgcggttcgactt
tgtttccaggtctggatccgggatacgaacacggggcacttgattcagctgcccctggtg
ttctcccaacccatctacgacaatcgtgcgcccaatacagccgagctgaaaatttgccgc
gtcaaccgcaattcggggacctgcctgggcggagatgaaatcttcctcctctgtgacaaa
gtgcagaaagaggacatcgaagtccgctttttcaaggattcctgggaagcaaaagggtcc
ttctcgcaggccgatgtacaccgccaggtggccattgtcttcaagacgccaccctacgcg
gatcagacaatccgtgaacccgtgacggttcagatgcagctgcaccgtccctccgacaaa
gaagtcagtggctccatggaattccgttacctcccggatgaaggcgatttccatcgaatc
gaggagaagcgcaaacgaaccctgggcacttttaaaaccttcgtacagaaaacacctttt
gcagtagggaccacggaagcacaatctccacgccgcatggccgtaccaaaacacggagca
ccccggcctaccaccagcaccgtgccagggtttttgggagcatccagccactcgcccatg
cgcccaattcagaagccgcaagtcatggctcagccttctgccggcttcttcgttgggtcc
agccaccccaccccgctgcctcccatggccactgcggctgcctccaacttcagcactgtg
aacatggaggatctgtcgtgcctgggcgtctcctcacaggccccaacttcctccatggac
accgaaaacagcatcgccgatgccttcctgcaactccactttgaaggcggggatcccttg
gtgggccttttggaagacaccacctacaacagcctggatagcatcaacaccaccgagttc
cggcagctgctcaacgaaggcccgggccccgcgccgctgccaggggacacccaggggact
ctgatgacctacccggaatccatcactcgcttggtcagccagcggagggcgggaggggag
tccggcggcaatggggacggtggggggaccgcccattcgaccaacaacagcttcctcaac
ggccttttggggacctttaccgaggacagcttttcgtccatgggtgacctggatttgaac
tcgcttctcaactcgtaa

DBGET integrated database retrieval system