KEGG   Treponema succinifaciens: Tresu_0478Help
Entry
Tresu_0478        CDS       T01461                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tsu  Treponema succinifaciens
Pathway
tsu00473  D-Alanine metabolism
tsu00550  Peptidoglycan biosynthesis
tsu01100  Metabolic pathways
tsu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Tresu_0478
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tresu_0478
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Tresu_0478
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tsu01011]
    Tresu_0478
Enzymes [BR:tsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Tresu_0478
Peptidoglycan biosynthesis and degradation proteins [BR:tsu01011]
 Precursor biosynthesis
  Amino acid ligase
   Tresu_0478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp RimK
Motif
Other DBs
NCBI-ProteinID: AEB13428
UniProt: F2NXV8
LinkDB All DBs
Position
525242..526372
Genome map
AA seq 376 aa AA seqDB search
MNVVLIYGGKSGEHEISLLSCASVIRNISAKHNVSLISISKGGKWYLEDDSVFKEIRNNP
EAALCVHENESREVKVSFGRGKDNVFFACGNYIPCDVVFPVLHGTYGEDGTVQGVFEMAG
VPFVGCGVLASSAAMDKETTKILLKNAGIPVVPYMCISRSQINSSSLYDKLIEEAIEKLE
FPLFVKPCAAGSSDGASLARNKRELSFALMEAFSWDNKVLIEKAIDAREVECSVTGNSVT
ATSESDCTLLKAYGPGEIVPKHDFYDYDAKYNDPDGAELKIPALLSDDKLELIRETAKKA
YSVINASGLSRVDFFVDRKTGEIYLNEINTIPGFTKISMFPKMCDADGLEYSELIDYLLK
EGIENFKAKQSLCTSR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtggttttaatatacggtggaaaatcaggcgagcatgaaatttcacttttgtca
tgcgcatctgtaatcagaaacatcagcgcaaagcacaacgtttctctcatttcgatttcc
aaaggcggaaaatggtatcttgaagacgattcagtttttaaggaaataagaaacaatccc
gaagccgctctttgtgttcatgaaaatgaaagccgtgaagtaaaagtttcgtttgggcgt
ggaaaagacaatgtgttttttgcctgcggaaactacattccatgcgatgttgtgttcccg
gttctgcatggaacttacggagaagacggaactgttcagggggtatttgaaatggctggc
gttccattcgttggctgcggagttttggcttcaagcgcggcaatggacaaggaaactaca
aaaattcttttaaagaacgcaggaattccagttgttccatatatgtgcatttcaagaagc
cagataaattcaagttctctttatgacaagcttattgaagaagcgattgaaaaacttgag
tttccgctttttgtaaagccatgcgctgcaggttcaagcgacggagcaagtcttgcccgg
aataaaagagagctttcttttgcgctcatggaagcattcagctgggacaacaaagttctt
attgaaaaagcgattgacgctcgggaagttgaatgctctgtaactggaaattctgtaacg
gcaacttcggaatctgactgcacgcttttaaaggcttacggaccgggagaaattgttcca
aagcatgatttttatgactacgatgcaaaatacaacgacccggacggagctgagctaaaa
attcccgctcttctttcagatgacaagcttgagctcataagggaaactgcaaaaaaagcg
tattcagtaataaacgcatcgggtttgagccgcgtggatttttttgtggaccgcaagact
ggcgaaatttacctgaacgagataaacacaattccgggatttacaaaaatcagtatgttc
cccaaaatgtgcgatgcagacggattggaatattctgagcttattgattatcttctaaaa
gagggaattgaaaatttcaaggcgaaacaaagcctttgcacttcaagatag

DBGET integrated database retrieval system