KEGG   Treponema succinifaciens: Tresu_1557Help
Entry
Tresu_1557        CDS       T01461                                 

Definition
(GenBank) Hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
tsu  Treponema succinifaciens
Pathway
tsu00010  Glycolysis / Gluconeogenesis
tsu00051  Fructose and mannose metabolism
tsu00052  Galactose metabolism
tsu00500  Starch and sucrose metabolism
tsu00520  Amino sugar and nucleotide sugar metabolism
tsu00521  Streptomycin biosynthesis
tsu01100  Metabolic pathways
tsu01110  Biosynthesis of secondary metabolites
tsu01120  Microbial metabolism in diverse environments
tsu01130  Biosynthesis of antibiotics
tsu01200  Carbon metabolism
Module
tsu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tresu_1557
   00051 Fructose and mannose metabolism
    Tresu_1557
   00052 Galactose metabolism
    Tresu_1557
   00500 Starch and sucrose metabolism
    Tresu_1557
   00520 Amino sugar and nucleotide sugar metabolism
    Tresu_1557
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tresu_1557
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Tresu_1557
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tsu04131]
    Tresu_1557
Enzymes [BR:tsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Tresu_1557
Membrane trafficking [BR:tsu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Tresu_1557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-ProteinID: AEB14457
UniProt: F2NT05
LinkDB All DBs
Position
complement(1681717..1683006)
Genome map
AA seq 429 aa AA seqDB search
MNRKVAAFLGRHNFSIHQDINSIVEAMLFDMNEGLSGRPSGEDMIRTYANPPSQATAGKS
VIVIDAGGTNFRSCLVTFDSNGNPSIDFMEKTRMPGVDRELSKKEFFDQISANLEHLKDK
SSSIGFCFSYPVDIQEDGDGVLINFTKEVKAPEVEGSHIGKELEKALKEHGWKNKLHVSM
LNDTVSALLAGAADPDEGMKYSSYVGFILGTGMNSAYIQTASPEYKNLKTQIINCESGKF
DKVARSDFDISFDKKSEKPGIGIMEKLCSGAYMGPIAFEAVTAAGKENLFSEKLSEKLSQ
LDSLTQIEMDSFLHAPYSTNSKLGSIMAECAKDDDYDVLFQLLDALVERCARMAAAILSA
CVIKSGEGKTADKPVCILCNGTSFFKTYKVRQRVLGYLEEILVKERGLYFDVISRENDIT
LGTAIGGLL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaaaagttgcggcctttttgggcagacacaatttcagcatccatcaggacatt
aattcaattgttgaagctatgctttttgatatgaatgaaggattgagcggccgtccttct
ggcgaggatatgattagaacttatgcgaatcctccatctcaggctacagctggaaaaagt
gttattgtaattgatgccggcggaacaaatttccgctcttgccttgtaacttttgattca
aacggaaatccttcaattgattttatggaaaaaacaagaatgcctggtgttgaccgcgag
ctttctaaaaaagaattttttgaccagatttcggcgaaccttgagcatttaaaagacaag
tcttctagcattgggttctgcttttcttatccagttgacattcaggaagatggcgacggc
gttcttattaactttacaaaagaagtaaaagctcctgaagttgaaggctcccacatcgga
aaagaacttgaaaaagcattgaaggaacacggctggaaaaacaagcttcatgtttcaatg
ctgaacgacacggtttctgccttgcttgctggagctgccgacccggatgaaggaatgaaa
tattcttcttacgttggatttattcttggaactggaatgaattccgcatacattcagact
gcaagcccggaatacaaaaatttaaagacacagattataaactgcgagtctggaaaattc
gacaaggttgcaagaagtgactttgatatttcgtttgacaaaaaaagtgaaaagcctgga
atcggcattatggaaaaactttgctcaggcgcatacatgggaccgattgcttttgaagct
gttacagcagcaggcaaggaaaatcttttttcagaaaagctttcagaaaaactttctcag
cttgattctcttactcaaattgaaatggattcgttccttcatgctccatattcaacaaat
tcaaagcttggctcaattatggctgaatgcgccaaggacgatgactacgatgttttgttt
cagttgcttgatgcgcttgtagaacgttgcgctagaatggctgccgcaattttgtctgcc
tgcgtaataaaaagcggggaaggaaaaactgccgataagcctgtctgcattctttgcaac
ggaacttcattctttaaaacttataaagttcgccagcgtgttcttggttatcttgaagag
attcttgtaaaggaacgcggactttactttgatgtaatcagccgtgaaaacgacattact
cttggcactgcgattggcggtcttctttaa

DBGET integrated database retrieval system