KEGG   Candidatus Thiodictyon syntrophicum: THSYN_11365Help
Entry
THSYN_11365       CDS       T05211                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
tsy  Candidatus Thiodictyon syntrophicum
Pathway
tsy00010  Glycolysis / Gluconeogenesis
tsy00620  Pyruvate metabolism
tsy01100  Metabolic pathways
tsy01110  Biosynthesis of secondary metabolites
tsy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THSYN_11365
   00620 Pyruvate metabolism
    THSYN_11365
Enzymes [BR:tsy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     THSYN_11365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA HlyC
Motif
Other DBs
NCBI-ProteinID: AUB81491
UniProt: A0A2K8U8X9
LinkDB All DBs
Position
complement(2721731..2723251)
Genome map
AA seq 506 aa AA seqDB search
MIYANPGQPGSKITFKKRYDNFIGGRWTPPAKGAYFENVSPVNGKGFCEVARSSAEDIEA
ALDAAHAAREGWGKTPAAERANILVKIAQRMEDNLELLAVAETWDNGKPVRETLAADLPL
AIDHFRYFAGCIRAQEGSLSEIDETTVAYHFHEPLGVVGQIIPWNFPLLMATWKLAPVIA
AGNCVVLKPAEQTPVGILVWAELIGDLLPPGVLNIVNGFGLEAGKPLASSPRIAKIAFTG
ETTTGRLIMQYAAQNLIPVTLELGGKSPNIFFDDVCAADDDFFDKAVEGFVMFALNQGEV
CTCPSRALIQESIYDRFMAKALARVKAIKQGNPLDTDTMLGAQASSEQREKILSYFEIGR
QEGAEVLTGGAAANLGGDLEGGYYIQPTVFLGNNRMRIFQEEIFGPVVSVTTFKDEAEAL
HLANDTLYGLGSGVWSRDAGRCFRMGRGIHAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HRMMLDHYQQTKNLLVSYSPKALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatctacgccaatcccggccaacccggctccaagatcaccttcaagaagcgctacgac
aactttatcggcgggcgctggacgcccccggccaagggcgcctatttcgagaatgtctcc
ccggtcaacggcaagggcttctgcgaggtggcacgctccagtgccgaggacatcgaggcc
gcactcgacgccgcccacgccgcccgcgagggctggggcaagaccccggccgcagagcgc
gccaacatcctggtcaagatcgcccagcgcatggaggacaacctggagctgctggccgtg
gccgagacctgggacaacggcaagccggtgcgcgagaccctggccgcggacctgccgctg
gccatcgaccacttccgctatttcgccggctgcatccgcgcccaggaaggttcgctgtcg
gagatcgacgagaccaccgtcgcctaccacttccatgagccgctgggcgtggtcggccag
atcatcccctggaacttcccgctcctgatggcgacttggaagctcgccccggtgatcgcc
gccggcaactgcgtggtgctcaagcccgccgaacagaccccggtcggtatcctggtgtgg
gccgagttgatcggggatctcctgccccccggggtcctcaatatcgtcaacggctttggc
ctggaggccggcaagccgctggcgtcgagcccgcgcattgccaagatcgccttcaccggt
gagaccaccaccggccggctgatcatgcagtacgcggcacagaacctgatcccggtcacg
ctcgaactgggcggcaagtcgcccaacatcttcttcgacgatgtctgtgccgccgacgac
gacttcttcgacaaggcggtcgagggcttcgtcatgttcgcgctcaaccagggcgaggtc
tgtacctgccccagccgcgccctgatccaggagtcgatctacgaccgtttcatggccaag
gccctggcccgggtcaaggcgatcaagcaggggaacccgctcgacaccgacaccatgctc
ggcgcccaggcatccagcgaacagcgcgagaagatcctgagctacttcgagatcggtcgc
caggaaggggccgaggtcctgaccggcggggccgcggccaacctgggcggtgatctggag
ggcggctattacatccagccgaccgtgttcctgggcaacaaccggatgcgcatcttccag
gaggagatcttcggccccgtggtctcggtcaccaccttcaaggacgaggccgaggccctg
cacctcgccaacgacaccctctacggcctgggctccggggtctggagccgcgatgccggg
cgctgcttccgcatgggccgcggcatccacgccggccgcgtctggaccaactgctaccac
gcctacccggcccacgccgccttcggcggctacaagcagtccggcatcgggcgcgagacc
caccgcatgatgctcgaccactaccagcagaccaagaacctgctcgtgagctacagcccc
aaggcactgggcttcttctag

DBGET integrated database retrieval system