KEGG   Candidatus Thiodictyon syntrophicum: THSYN_29480Help
Entry
THSYN_29480       CDS       T05211                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
tsy  Candidatus Thiodictyon syntrophicum
Pathway
tsy00630  Glyoxylate and dicarboxylate metabolism
tsy01100  Metabolic pathways
tsy01120  Microbial metabolism in diverse environments
tsy01200  Carbon metabolism
Module
tsy_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:tsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    THSYN_29480
Enzymes [BR:tsy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     THSYN_29480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AUB85066
UniProt: A0A2K8UHK8
LinkDB All DBs
Position
pTs417:80336..80680
Genome map
AA seq 114 aa AA seqDB search
MRTNSTVGDYQTAQTLETFGFLPKLTQDEIYDQIAYLIGNGWTPAIEHEHPSRSTDHYWT
MWKLPFFGEQDMDRVMAEIDACHQAYPTHHVRLIGYDNYTQSQGVSFVVIEGRT
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaccaactccacggtgggcgactaccagaccgcccagaccctcgaaaccttcggc
ttcctgccgaagctgacgcaggacgagatctacgaccagatcgcctatctgatcggtaac
ggctggacgccggccatcgagcacgagcacccgagccgctcgaccgatcactactggacc
atgtggaagctgccgttcttcggcgagcaggacatggaccgcgtgatggccgagatcgat
gcctgccaccaggcctacccgactcaccatgtgcgcctcatcggctacgacaactacacc
cagagccaaggggtgtcgttcgtggtcatcgagggtcgcacctga

DBGET integrated database retrieval system