KEGG   Candidatus Thiodictyon syntrophicum: THSYN_30770Help
Entry
THSYN_30770       CDS       T05211                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
tsy  Candidatus Thiodictyon syntrophicum
Pathway
tsy00061  Fatty acid biosynthesis
tsy00780  Biotin metabolism
tsy01100  Metabolic pathways
tsy01130  Biosynthesis of antibiotics
tsy01212  Fatty acid metabolism
Module
tsy_M00083  Fatty acid biosynthesis, elongation
tsy_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:tsy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    THSYN_30770
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    THSYN_30770
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    THSYN_30770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tsy01004]
    THSYN_30770
Enzymes [BR:tsy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     THSYN_30770
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     THSYN_30770
Lipid biosynthesis proteins [BR:tsy01004]
 Fatty acid synthase
  Component type
   THSYN_30770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AUB85289
UniProt: A0A2K8UII1
LinkDB All DBs
Position
pTs417:381422..382201
Genome map
AA seq 259 aa AA seqDB search
MIDSDYFNLEGKRGLVIGVANMDSIAYGCARAFRTLGADLAITYLNEKARPFVEPAARAV
GAELFLPCDVMVPGELEAVFAAIGERWGRLDFVLHSIAFAPRADLQGRLVDSSAEGFGLA
VNISVHSFLRVAHLAEPLMPQGGSLFAMTFYGADKVLSTYNLMGPVKAALESAVRYTAAE
LGPQGIRAYAISPGPMLTRAATGLKDFDELRDAAEERAPLGRLAEIDDVGAVVAMLATRT
GTMLTGQIIYVDGGYHITG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatcgattcggactatttcaacctcgagggcaagaggggcctggtgatcggggtcgcc
aacatggactcgatcgcctacggctgcgcgcgcgcctttcgtaccctgggtgcggacctg
gcgatcacctatctcaacgagaaggcccgtcccttcgtggagcccgccgcccgggcggtc
ggtgccgagctctttctgccctgcgatgtgatggtgccgggggagttggaggccgtcttc
gccgccatcggcgagcgctggggtcggctcgacttcgtgctgcattcgatcgccttcgcc
ccgcgggcggacctgcagggtcggctggtggactcctccgccgaagggttcggcctggcg
gtgaacatctcggtccactccttcctgcgggtggcccatctcgccgagccgctgatgccc
caaggcggttcactctttgccatgaccttctacggggcggacaaggtgctgtccacctac
aacctgatgggcccggtcaaggccgcgctggaatcggcggtgcgctacaccgcggccgag
ttggggccccaaggtatccgtgcctatgccatctcccccggtcccatgctgacccgcgcc
gccaccgggctcaaggacttcgatgaattgagggacgccgccgaggagcgcgcgccgctc
gggcggctggccgagatcgacgacgtgggggcggtcgtggccatgctggcgacccgcacc
ggcaccatgctgaccggccaaatcatctatgtggacggcggttaccacatcactggttag

DBGET integrated database retrieval system