KEGG   Candidatus Thiodictyon syntrophicum: THSYN_30845Help
Entry
THSYN_30845       CDS       T05211                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
tsy  Candidatus Thiodictyon syntrophicum
Pathway
tsy02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:tsy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    THSYN_30845
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tsy02000]
    THSYN_30845
Enzymes [BR:tsy01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     THSYN_30845
Transporters [BR:tsy02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    THSYN_30845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N Rad17 AAA_22 AAA_15 RsgA_GTPase AAA_29 AAA_18 AAA AAA_23 Relaxase AAA_16 ATP-synt_ab NB-ARC AAA_33 AAA_28 RNA_helicase AAA_PrkA
Motif
Other DBs
NCBI-ProteinID: AUB85302
UniProt: A0A2K8UIF4
LinkDB All DBs
Position
pTs417:395792..396616
Genome map
AA seq 274 aa AA seqDB search
MNAAAETMFIAEPYQVAGEVVIECNVAKIFYGDFLAVRDSVVPIEKKKITGFIGPSGCGK
STVLRSLNRMNDLISVFRFEGSVLYHGQDVYATKVDPVLVRRYIGMVFQQPNPFSMSVYD
NVAFGLRLNRYKGDMDERVQKALERAALWKEVKDKLKNSGLSLSGGQQQRLCIARAIATE
PDVLLMDEPCSALDPIATRQVEELMLELKERYTLALVTHNMQQATRVADTTAFFSVDISK
GGRTGYLVEMGPTGQVFQSPREQLTKEYISGEFS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagcagcagagacgatgttcattgccgagccataccaggtcgcgggcgaggtc
gtcatcgagtgcaacgtcgccaagatcttctacggtgacttcctcgcggtgcgcgacagc
gtggtgccgatcgagaagaagaagatcaccggcttcatcggcccctcgggctgcggcaag
tcgacggtgctgcgcagtctcaaccggatgaacgacctgatctcggtcttccgcttcgag
ggcagcgtgttgtaccacggccaggacgtctatgcgacgaaggtagacccggtgctggtg
cgccgctatatcggcatggtcttccagcagcccaaccccttctcgatgagcgtctatgac
aatgtcgccttcggcctgcggctcaaccgctacaagggcgatatggatgagcgcgtgcag
aaggccctggagcgggccgccctctggaaggaggtcaaggacaagctcaagaacagcggg
ctctcgctctccggcggccagcagcagcgcctgtgcatcgcgcgggccatcgccaccgaa
cccgacgtgctcctgatggacgagccctgttcggcgctcgaccccatcgccacccgccag
gtggaggaattgatgctggagctcaaggagcgctataccctggcgctcgtgacccacaac
atgcagcaggcgacccgggtcgccgacaccaccgccttcttctcggtggacatctccaag
ggcgggcgcaccggctatctggtcgagatgggccccaccgggcaggtcttccagagcccc
agggagcagctcaccaaggaatacatctccggtgagttcagttga

DBGET integrated database retrieval system