KEGG   Pseudothermotoga thermarum: Theth_1985Help
Entry
Theth_1985        CDS       T01554                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
tta  Pseudothermotoga thermarum
Pathway
tta00260  Glycine, serine and threonine metabolism
tta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Theth_1985
Enzymes [BR:tta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     Theth_1985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AEH52025
UniProt: F7YWN7
LinkDB All DBs
Position
2009604..2010638
Genome map
AA seq 344 aa AA seqDB search
MLAIRKTSMAAGLSMENVEQPKELAPNEVLVKVKKASICGSDVHIYKWDKWAQSHIRPPM
TIGHEFAGVVEAVGEAVDTVKVGDYVAAESHIPCQNCYQCRTGRMHICKDMKILGVDIDG
AFAQYIKVPQVILWKVSKEIPEEYASVMEPFGNAVHATLVEDLTGKTVLITGVGPIGAMA
IQVAKAAGASLVIASEIREYRKQLAKINGADVVIDPSCQDLEKEVVKLTNGEGVDVVIEM
SGNVQALLDGLKCVTRGGAVSILGVYSKNVEIPIDEFVTFKGLKVYGITGRKMFETWRTA
DQLLKSKKVDLSKVVTHVIPFQDWQKGFELMIKGDCGKIVMEIS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgttggctataagaaaaacatccatggcggcaggtttaagtatggaaaatgttgaacaa
ccaaaagaacttgccccaaacgaggttcttgtaaaggttaaaaaagcatccatatgtggt
tcagacgttcacatctacaagtgggacaagtgggcacaaagccatataagaccacctatg
acaattggtcatgaatttgctggagttgttgaagcagttggagaggctgttgatacagtc
aaggtaggagattacgtcgccgccgaatcacatataccatgtcaaaattgctatcaatgc
agaactggtcgaatgcatatttgcaaggatatgaaaatactaggtgttgatatcgatgga
gcttttgcacagtacataaaggttccgcaagtaattctttggaaagtttcaaaagagatc
ccagaagaatatgcttcagttatggaaccttttggcaacgctgtgcatgcaactttggtg
gaagatttgactggaaaaactgttttgataaccggagttggtccaatcggtgctatggct
attcaagttgcaaaggctgcaggagcatctcttgttatagcgtcagaaataagagaatac
agaaaacaacttgcaaaaataaacggtgctgatgtggtcatcgatccatcttgtcaagat
cttgaaaaagaggtggtgaaactcacaaacggtgaaggtgtggatgttgtaattgaaatg
tctggtaacgtgcaagcattgcttgatggtctaaagtgtgtgacaagaggtggggcagtt
tctatcctgggcgtttacagcaagaacgttgagataccgattgatgaatttgttactttt
aagggtttaaaggtgtacggtataaccggaaggaaaatgttcgaaacttggagaacagct
gatcaacttttgaaaagtaaaaaggttgatttatcaaaagtggtaactcacgttattcct
tttcaagattggcaaaagggttttgagttgatgatcaaaggcgattgtggaaaaattgtg
atggaaatttcctaa

DBGET integrated database retrieval system