KEGG   Thiohalobacter thiocyanaticus: FOKN1_0495Help
Entry
FOKN1_0495        CDS       T05229                                 

Definition
(GenBank) ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
ttc  Thiohalobacter thiocyanaticus
Pathway
ttc00630  Glyoxylate and dicarboxylate metabolism
ttc01100  Metabolic pathways
ttc01120  Microbial metabolism in diverse environments
ttc01200  Carbon metabolism
Module
ttc_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:ttc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    FOKN1_0495
Enzymes [BR:ttc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     FOKN1_0495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BAZ92899
UniProt: A0A1Z4VMP7
LinkDB All DBs
Position
509372..509731
Genome map
AA seq 119 aa AA seqDB search
MSEMQDYESSLSDPSSRKFETFSYLPEMEKDRIRKQVEYIVKQGWNPAIEHTETENAFGH
YWYMWKLPMFGETDVDRILGEAEACHKAHPEHHVRLVGYDNYAQSQGASMVIFRGPIKV
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaatgcaagattacgaatccagcctgagcgatccttcaagccggaagttcgag
accttctcctatctgccggaaatggaaaaggaccggatccgcaagcaggtggagtacatt
gtcaagcagggctggaatccggccatcgagcataccgagacggagaacgccttcggtcac
tactggtacatgtggaagttgccgatgttcggcgagaccgacgtcgatcgcatcctgggg
gaggccgaggcctgccacaaggcgcatcccgagcatcacgtgcgcctggtcggctatgac
aactacgcccagtcgcagggtgcttcaatggtcatcttccgcggcccgatcaaggtctga

DBGET integrated database retrieval system