KEGG   Thiohalobacter thiocyanaticus: FOKN1_0976Help
Entry
FOKN1_0976        CDS       T05229                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ttc  Thiohalobacter thiocyanaticus
Pathway
ttc00620  Pyruvate metabolism
ttc00680  Methane metabolism
ttc01100  Metabolic pathways
ttc01120  Microbial metabolism in diverse environments
ttc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ttc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FOKN1_0976
  09102 Energy metabolism
   00680 Methane metabolism
    FOKN1_0976
Enzymes [BR:ttc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     FOKN1_0976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DinB
Motif
Other DBs
NCBI-ProteinID: BAZ93376
UniProt: A0A1Z4VP12
LinkDB All DBs
Position
complement(1020738..1023554)
Genome map
AA seq 938 aa AA seqDB search
MWAMIDQPRDKELRARVRLLGSLLGNVLRDQEGGQVLDAVETLRKGFIRLRKVDDPKLRS
RLMRMIDQLNPAILTHVVRAFNVYFSLVNIAEQAFQHRQRRREVSTGKRLWLGSFDDTLR
QFREQGIGPDQLQTLLDRTLYLPVFTAHPTESKRRTIMEALRRIFVVSEQLDQRLNREQR
QEVIRELESQIQILWKTDEVRTHRPRVVDEIRHGLFYFRESLFEAIPTLYRNLEKSIRRT
YGEELEGQPVNTPTLLRFGSWIGGDRDGNPFVKPETTEMALHLHMREAVICYMRRLDALR
HLLTHSSNLITPTPEFSAALAEDVKRYGDSAFRDHPHRFEHEPYRRKLYVMRYRLRQNLT
LLNAKLEADETDCPGCEDRYLHEQELLSDLCLIRDSLVSHGDARIADGKLQDLIRLVETF
GFFLLQLDIRQESTRHTEAVAEILQALEGADYNALDEAGRLQCLAERIAAGAPPRLAPDS
YSESTRETLAVFDVMQRMQDEISPNAFGNYVISMTHTASHVMEVMYLAWLNRLAGRNNGD
WHCRIRISPLFETIEDLSHVEEVLQALLNNATYRALLAASGNQQEIMLGYSDSCKDGGIV
ASSWNLYEAQKKIIRMTTELGVDCRLFHGRGGTIGRGGGPTHESILAQPPGTVHGQIKFT
EQGEVLSYKYSQLETTVYELTMGLTGLMKASRCVVQEVPHDREDYLGIMDALTRTGEAVY
RELTDRTEGFLDYFYEVCPVDEIGLLNIGSRPSHRSKANRSKSSIRAIPWVFGWAQSRHT
LPAWYGLGSALEQWRNNDPNRLAKLQTMYREWPYFRALLSNIQMSLFKAQFDIAREYTRL
AHDPDQAAHIYDTIREEFRRTLTQVLNIADIQLLLEETPSLHLSLSRRDPYLDPLNHIQV
TLLKRYRNESLGEADREAWRDPLLRSINAIAAGMRNTG
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgtgggccatgatcgatcaaccccgcgacaaggaactccgcgcccgcgtgcgcctgctg
ggcagcctgctcggcaacgtgctgcgcgatcaggaaggcggtcaggtgctggacgcggtg
gagaccctgcgcaagggcttcatccgcctgcgcaaggtcgacgacccgaagctgcgcagc
cgcctgatgcggatgatcgaccagctcaacccggccatcctcacccacgtggtgcgcgcc
ttcaatgtctacttcagcctggtcaatatcgccgagcaggccttccagcaccgccagcgc
cggcgcgaggtcagcaccggcaagcgcctgtggctgggttccttcgacgacaccctgcgc
cagttccgcgagcagggcatcggcccggaccagctccagaccctgctcgaccggaccctg
tacctgccggtgttcacggcccacccgaccgaatccaagcgccgcaccatcatggaggcg
ctgcgccgcatcttcgtggtcagcgagcagctcgaccagcgcctgaaccgggaacagcgc
caggaggttatccgggaactggagagccagatccagatcctgtggaagaccgacgaggtg
cgcacccaccgtccgcgggtggtcgacgagatccgccacggcctgttctacttccgcgaa
agcctgttcgaggccatccctacgctctatcgcaacctggagaagtccatccgccgcacc
tacggcgaggaattggaaggacaaccggtcaacacgccgaccctgctgcgtttcggttcc
tggatcggcggcgaccgggacggcaatcccttcgtcaagcccgaaaccaccgagatggcg
ctgcacctgcacatgcgcgaggcggtgatctgctacatgcgccggctggacgcgctgcgc
cacctgctgacccattccagcaacctgatcacaccgacgcccgagttcagcgccgcgctg
gccgaggacgtcaagcgctacggcgacagcgcattccgggaccatccgcaccgcttcgag
cacgaaccctatcggcgcaagctctatgtcatgcgctaccggctgcgtcagaacctcacc
ctgctcaatgccaagctggaggcggacgagacggactgccccggctgcgaggaccgctac
cttcacgaacaggaactgctgagcgatctgtgcctgatccgggattcgctcgtcagccac
ggggatgcccgcatcgccgatggcaagctgcaggacctgatccggctggtggagaccttc
ggcttcttcctgctgcaactcgacatccgccaggaatcgacccgccacaccgaggccgtg
gccgagatcctgcaggcgctcgagggcgccgactacaacgccctggacgaggccggccgg
ctgcagtgtctggccgagcggatcgccgccggcgcgccgccgcggctggcgccggacagt
tacagcgaatccacccgcgagaccctggcggtgttcgacgttatgcagcgcatgcaggac
gagatcagccccaacgccttcggcaattacgtcatctccatgacccacaccgccagccac
gtgatggaggtgatgtacctggcctggctcaaccgcctggccggaaggaacaacggcgac
tggcactgtcgcatccgcatcagccccctgttcgagacgatcgaggacctgtcccacgtc
gaggaggtgctgcaggcgctgctcaacaatgccacctaccgcgccctgctcgccgcctcc
ggcaaccagcaggagatcatgctgggctactccgactcctgcaaggacggcggcatcgtc
gcctccagctggaacctgtacgaggcgcagaagaagatcatccgcatgaccaccgagctg
ggcgtggactgccggctgttccacggccgcggcggcaccatcggccgcggcggcggtccc
acccacgaatccatcctggcgcagccgccgggtacggtgcacggccagatcaagttcacc
gagcagggtgaggtgctgtcctacaagtacagccagctcgagaccaccgtctacgagctg
accatgggcctgaccggcctgatgaaggccagccgctgcgtggtccaggaagtcccccat
gatcgcgaggactacctgggcatcatggacgccctgacccggacgggtgaggcggtctac
cgtgaactgaccgaccgcaccgagggcttcctggactatttctacgaggtctgtccggtc
gacgagatcgggctgctcaacatcggctcccggcccagccaccgcagtaaggccaaccgt
tccaagtcatcgatccgcgccatcccctgggtgttcggctgggcccagtcgcgccatacc
ctgccggcctggtacggcctgggttcggcactggaacagtggcgcaacaacgaccccaac
cggctggccaagctgcagaccatgtaccgggagtggccctacttccgcgccctgctcagc
aacatccagatgtcgctgttcaaggcgcaattcgacatcgcccgggaatacacccgcctg
gcccatgacccggatcaggccgcgcacatctatgacaccatccgcgaggagttccgacgc
accctgacccaggtcctgaacatcgccgatatccagctgctgctggaggaaacgccctcg
ctgcacctgtcgctgagccggcgcgacccgtacctggacccgctgaaccacatccaggtc
accctgctcaagcgctaccgcaatgagtcgctgggcgaggccgaccgtgaggcctggcgc
gacccgctgctgcgttccatcaacgccatcgccgccgggatgcgcaataccggctga

DBGET integrated database retrieval system