KEGG   Thiohalobacter thiocyanaticus: FOKN1_1592Help
Entry
FOKN1_1592        CDS       T05229                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ttc  Thiohalobacter thiocyanaticus
Pathway
ttc00061  Fatty acid biosynthesis
ttc00780  Biotin metabolism
ttc01100  Metabolic pathways
ttc01130  Biosynthesis of antibiotics
ttc01212  Fatty acid metabolism
Module
ttc_M00083  Fatty acid biosynthesis, elongation
ttc_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ttc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FOKN1_1592
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    FOKN1_1592
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    FOKN1_1592
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ttc01004]
    FOKN1_1592
Enzymes [BR:ttc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     FOKN1_1592
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     FOKN1_1592
Lipid biosynthesis proteins [BR:ttc01004]
 Fatty acid synthase
  Component type
   FOKN1_1592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: BAZ93980
UniProt: A0A1Z4VQQ7
LinkDB All DBs
Position
complement(1670318..1671103)
Genome map
AA seq 261 aa AA seqDB search
MGFLAGKRALIVGLASNRSIAWGIAQAMQREGAELAFTYQNEKLQGRVEKMAGELGSDIT
LPLDVSSDEQIDKVFTELGKRWDGLDILVHSVAFAPKEALEGSFVDSVTRDNFATAHDIS
SYSFAALAKAARPLMAGRNGALLTLSYLGAVRAMPSYNVMGLAKASLEANVRFLAYSLGP
EGTRVNAVSAGPIRTLAASGIGNFRKLLEYGEQNAPLRRNVSIEEVGNAAAFLCSDLASG
ITGEITYVDGGYNIVGAPEME
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggatttctcgccggaaaacgcgcactcatcgtcggcctggccagcaaccgctccatc
gcctggggcatcgcccaggccatgcagcgtgaaggcgcggaactggcctttacctaccag
aacgaaaagctccagggccgggtcgagaaaatggctggcgaactgggctcggacatcacc
ctgccgctggacgtgagttcggatgagcagatcgacaaggtcttcaccgaactgggcaag
cgctgggacggcctggatatcctggtccattccgtggcctttgcccccaaggaggcgctg
gaaggcagcttcgtcgacagcgtgacccgcgacaactttgccaccgcccatgacatcagt
tcctacagcttcgccgccctggccaaggcggcgcgtccgctgatggccggccgcaacggc
gccctgctcaccctgagctacctgggggcggtgcgcgccatgcccagctacaacgtcatg
ggtctggccaaggccagcctggaggccaacgtgcgctttctggcctacagcctgggcccg
gaaggcacccgggtgaatgccgtctcggccggcccgatccgcaccctggccgcctccggc
atcggcaacttccgcaagctgctggagtatggcgagcagaacgccccgctgcggcgcaat
gtcagcatcgaggaagtcggcaacgccgccgccttcctgtgctcggacctggccagcggc
atcaccggcgagatcacctatgtcgacggcggctacaacatcgtcggcgcgccggagatg
gaatag

DBGET integrated database retrieval system