KEGG   Thiohalobacter thiocyanaticus: FOKN1_2597Help
Entry
FOKN1_2597        CDS       T05229                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
ttc  Thiohalobacter thiocyanaticus
Pathway
ttc03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ttc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    FOKN1_2597
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ttc03400]
    FOKN1_2597
Enzymes [BR:ttc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     FOKN1_2597
DNA repair and recombination proteins [BR:ttc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     FOKN1_2597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: BAZ94967
UniProt: A0A1Z4VTK5
LinkDB All DBs
Position
complement(2749776..2750495)
Genome map
AA seq 239 aa AA seqDB search
MGIEAWVRRVPPAAESPAIAPEPVVEATPGPEPEPAAATAAADNDAVATLGWEALRERVL
GCTACALHTSRTQAVFGVGNPEADWLIVGEAPGAEEDRRGEPFVGRAGQLLDAILRAAGQ
DRTSAYIANILKCRPPNNRDPEPEEIGCCQDYLARQIALIRPRLILAVGRIAAQHLLATD
QPIGRLRGRVHRWGEAGIPLVVTYHPAYLLRSPGEKRKVWEDLQLAMQSIREPAEAARQ
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcgaggcctgggtgcggcgggtgccgccggcggccgaatcgccggcgatcgcg
ccggagccggttgtcgaggcaacgccgggccctgaaccggaaccggcagccgcaaccgca
gctgccgataatgatgcagtggcgacgctgggctgggaggcgctgcgcgagcgggtgctg
ggctgtaccgcctgcgcgcttcacaccagccgcacccaggcggtgttcggggtgggcaac
ccggaggccgactggctgatcgtgggcgaggcgcccggcgccgaggaggaccggcgcggc
gagcccttcgtcggccgtgccgggcagttgctcgatgccatcctccgggccgccggtcag
gaccgcacaagcgcctatatcgccaatatcctgaaatgccggccgcccaataaccgcgac
ccggagccggaggagatcggctgctgccaggactatctggcccgccagattgcgctgatc
cggccgcgcctgatcctggccgtgggccgcatcgccgcccagcacctgctggccacggac
cagcccatcggtcggctgcgtgggcgggtgcatcgctggggcgaggccggtatcccgctg
gtggtgacctaccaccccgcctatctgctgcgctcgcccggcgagaagcgcaaggtctgg
gaggatctgcagctggccatgcagagtatccgcgagccggcggaggcggcgcggcagtga

DBGET integrated database retrieval system