KEGG   Thiohalobacter thiocyanaticus: FOKN1_2792Help
Entry
FOKN1_2792        CDS       T05229                                 

Definition
(GenBank) 3-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
ttc  Thiohalobacter thiocyanaticus
Pathway
ttc00061  Fatty acid biosynthesis
ttc01100  Metabolic pathways
ttc01212  Fatty acid metabolism
Module
ttc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ttc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FOKN1_2792
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ttc01004]
    FOKN1_2792
Enzymes [BR:ttc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     FOKN1_2792
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     FOKN1_2792
Lipid biosynthesis proteins [BR:ttc01004]
 Fatty acid synthase
  Component type
   FOKN1_2792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: BAZ95152
UniProt: A0A1Z4VUQ1
LinkDB All DBs
Position
2939160..2939690
Genome map
AA seq 176 aa AA seqDB search
MSTSETPRQDSFSYEDLIRCGHGELFGPGNAQLPLPPMLMFDRITRISDTGGAHDRGEIR
AELDIRPDLWFFGCHFEGDPVMPGCLGLDAMWQLIGFFLGWSGGPGRGRALGSGEVKFSG
QVTPKNSLVRYQIDIKRIIKRRLFMGIADATMYVDDRAIYQANDLRVGLFTSTEGF
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaagcgagaccccccgccaggacagcttcagctacgaggatctgatccgctgc
ggccatggcgaactgttcggtcccggcaacgcccagctgccgctgccgcccatgctgatg
ttcgaccgcatcacccgcatcagcgacaccggcggcgcccatgatcggggcgagatccgg
gccgagctcgatatccggccggacctgtggttcttcggctgccatttcgagggcgacccg
gtcatgcccggctgcctgggcctggatgccatgtggcagctcatcggcttcttcctcggc
tggagcggcggtccgggccgcgggcgcgccctgggcagcggcgaggtcaagttcagcggc
caggtcacgccgaagaattccctggtcagataccagatcgacatcaagcgtatcatcaag
cggcgcttgttcatgggcatcgccgatgccaccatgtacgtcgacgaccgcgcgatctat
caggccaacgatctgcgggtcggtttgttcacatcaacggaagggttttga

DBGET integrated database retrieval system