KEGG   Thermococcus thioreducens: A3L14_03460Help
Entry
A3L14_03460       CDS       T05104                                 

Definition
(GenBank) phospholipase
Organism
ttd  Thermococcus thioreducens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn_dep_PLPC DUF1771 CUB LPAM_1
Motif
Other DBs
NCBI-ProteinID: ASJ11999
UniProt: A0A0Q2M4A8
LinkDB All DBs
Position
complement(634432..635721)
Genome map
AA seq 429 aa AA seqDB search
MKKVLSLIIALLAVSGLVSAWPTNGPTMDDPMNVHQKLTYKAIEAVYKDNPALGSILMQY
KDQLLYGAYDEDWTGGSIDIGGKTYTIQSQYHFLDPMDHAELFTVALLGDPDTSAADMAQ
RLYEKAVQLWKQGDRTGAMYYLGRALHIIEDQGMLIGHQTPHLFEDLEQEKYVENAHDFV
ENQISPTVADDILNNRVPLDLTPIKWWQIPQEKSRFIQGYDIYLTDNENGHMSLSNGVAW
AYADLAAHNSWRYMLYATGKDINLWSEWGHLGSYFWTRTLRKGDRSVLKLEFKGASSITI
VFKDIDMQNAYFKTLGYVEIYDKNWNLIARYAQDPNPLVDTRVTVPGDTVYIYTHVDSTA
WLDSDVDGWAIRNIELHANFDVNSPSGFRTLDGREYSKVQWAVYETMQYNIRLLAGLMEK
FFEDVGVTG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggttctgtccctgataatagcgcttttggccgtgtctggactggtctcagca
tggccgacaaacggcccaacgatggacgatccgatgaacgtccaccagaagctgacgtac
aaggcaatcgaggccgtctacaaggacaacccagccctcggaagcatactgatgcagtac
aaggatcagctcctttacggtgcgtacgacgaggactggacaggcggaagcatagacatc
gggggcaagacgtacaccatacagagccagtaccacttccttgaccccatggaccacgcc
gagctgtttactgtggccctccttggggatcctgacacatctgcggcagacatggcccag
aggctctatgaaaaggcggtacagctctggaagcagggcgacaggacaggagcgatgtat
tacctcggcagggcactccacataatcgaagaccagggcatgctcatagggcaccagacg
ccgcacctcttcgaagaccttgagcaggagaagtacgttgagaacgcccacgacttcgtt
gagaaccaaatctcaccgacagttgcggatgacattctgaacaaccgcgtcccgctcgac
ctcacaccgataaagtggtggcagataccccaggagaagtccagatttattcagggctac
gacatatacctcacggacaacgagaacggacacatgagcctctccaacggtgtcgcctgg
gcgtacgccgatctcgctgcacacaactcgtggagatacatgctctacgccacgggcaaa
gacataaacctatggagcgagtggggtcacctcggaagctacttctggacaagaaccctc
aggaagggagaccggagcgtcctcaagcttgagttcaagggtgccagctcgataaccata
gtcttcaaggacatcgacatgcagaacgcctacttcaagaccctcggctacgtagagata
tacgataagaactggaacctcattgccaggtatgcccaggatccgaacccgctcgttgat
accagggtcaccgttcccggggataccgtttacatctacacacacgttgacagtactgcc
tggcttgacagcgacgtggacgggtgggcgataaggaacatcgagctccatgcgaacttc
gacgtcaactcaccgagcggtttcagaaccctcgacggcagggagtacagcaaggtccag
tgggcggtttatgagaccatgcagtacaacatcagactgctcgcgggccttatggagaag
ttcttcgaggacgttggcgttactggctga

DBGET integrated database retrieval system