KEGG   Thermococcus thioreducens: A3L14_10600Help
Entry
A3L14_10600       CDS       T05104                                 

Gene name
porA
Definition
(GenBank) pyruvate ferredoxin oxidoreductase
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
ttd  Thermococcus thioreducens
Pathway
ttd00010  Glycolysis / Gluconeogenesis
ttd00020  Citrate cycle (TCA cycle)
ttd00620  Pyruvate metabolism
ttd00640  Propanoate metabolism
ttd00650  Butanoate metabolism
ttd00680  Methane metabolism
ttd00720  Carbon fixation pathways in prokaryotes
ttd01100  Metabolic pathways
ttd01110  Biosynthesis of secondary metabolites
ttd01120  Microbial metabolism in diverse environments
ttd01130  Biosynthesis of antibiotics
ttd01200  Carbon metabolism
Module
ttd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ttd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A3L14_10600 (porA)
   00020 Citrate cycle (TCA cycle)
    A3L14_10600 (porA)
   00620 Pyruvate metabolism
    A3L14_10600 (porA)
   00640 Propanoate metabolism
    A3L14_10600 (porA)
   00650 Butanoate metabolism
    A3L14_10600 (porA)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    A3L14_10600 (porA)
   00680 Methane metabolism
    A3L14_10600 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    A3L14_10600 (porA)
Enzymes [BR:ttd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     A3L14_10600 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ASJ13301
UniProt: A0A0Q2URP1
LinkDB All DBs
Position
1914521..1915705
Genome map
AA seq 394 aa AA seqDB search
MPIRKVMKANEAAAWAAKLAKPKVIAAFPITPSTLVPEKISEFVADGELDAEFIKVESEH
SAISACVGASAAGVRTFTATASQGLALMHEILFIAAGMRLPIVIAVGNRALSAPINIWND
WQDTISERDTGWLQFYAENNQEALDLILIAFKVAEDERVLLPAMVGFDAFILTHTVEPVE
IPDQELVDEFLGEYVPKHAYLDPSRPITQGTLAFPAHYMEARYTVWEANENAKKVIDEAF
AEFEKRFGRKYQKIEEYRTDDAEIIFVTMGSLAGTVKEYVDMLREKGVKVGVAKLTVYRP
FPTEEVRELAKKAKVLALLEKNVTFSVGGALFQDFSRALINEKEKPVIVDFILGLGGRDV
TFKDLDEALGIAQKALAGEEFDEVNWIGLRKEIL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaggaaggttatgaaggccaacgaagcggctgcctgggcggccaagctggcc
aagccgaaggttatagccgcattcccaattacaccgtccaccctggttccggagaagatc
agcgagtttgtcgcggatggggagctcgacgccgagttcatcaaggtcgagagcgagcac
tcagcgatttcagcctgtgtaggtgcctcagccgctggagtcagaaccttcacggccaca
gcttcccagggtctcgccctcatgcacgagatactcttcattgcagcaggaatgcgcctc
ccgatagtcatcgccgtcggaaacagggctttgagcgctccgattaacatctggaacgac
tggcaggacaccatcagcgagcgcgacaccgggtggctccagttctacgccgagaacaac
caagaagctttagacctcatcctgatagcgttcaaggtcgcggaggacgagagggttctc
ctcccggccatggtcggctttgacgcgttcatcctgacccacaccgtcgagccggttgag
attcccgaccaggagctcgttgacgagttcctcggcgagtatgtgccaaagcacgcctac
ctcgacccgagcaggccgataacccagggtaccctcgccttcccggcccactacatggag
gcgagatacaccgtctgggaggcaaacgagaacgccaagaaggtcattgacgaggccttt
gctgagttcgagaagaggtttggaaggaagtaccagaagattgaggagtaccgcacagat
gacgccgagataatcttcgtcaccatgggttcactcgccggaaccgtcaaggagtacgtt
gacatgctccgcgagaagggcgttaaggttggagtcgccaagctcaccgtctacaggccc
ttcccgaccgaagaggttagggagctggcgaagaaggccaaggtcttagctctgcttgag
aagaacgtcacattcagcgtcggcggggcactcttccaggacttcagcagggcacttatc
aacgagaaggagaagcccgtcatagttgacttcatcctcggccttggtggaagggacgtc
accttcaaggacctcgacgaggccctcggcatagcccagaaggccctcgctggagaggag
tttgatgaagtcaactggataggactgaggaaggagatactgtga

DBGET integrated database retrieval system