KEGG   Thermococcus thioreducens: A3L14_10840Help
Entry
A3L14_10840       CDS       T05104                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ttd  Thermococcus thioreducens
Pathway
ttd03030  DNA replication
ttd03410  Base excision repair
ttd03420  Nucleotide excision repair
ttd03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ttd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    A3L14_10840
   03410 Base excision repair
    A3L14_10840
   03420 Nucleotide excision repair
    A3L14_10840
   03430 Mismatch repair
    A3L14_10840
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ttd03032]
    A3L14_10840
   03400 DNA repair and recombination proteins [BR:ttd03400]
    A3L14_10840
Enzymes [BR:ttd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A3L14_10840
    6.5.1.6  DNA ligase (ATP or NAD+)
     A3L14_10840
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     A3L14_10840
DNA replication proteins [BR:ttd03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    A3L14_10840
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     A3L14_10840
DNA repair and recombination proteins [BR:ttd03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     A3L14_10840
   NER (nucleotide excision repair)
    Other NER factors
     A3L14_10840
   MMR (mismatch exicision repair)
    Other MMR factors
     A3L14_10840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2 Peptidase_S7 TPR_1
Motif
Other DBs
NCBI-ProteinID: ASJ13342
UniProt: A0A0Q2M5D6
LinkDB All DBs
Position
complement(1958038..1959717)
Genome map
AA seq 559 aa AA seqDB search
MKYAELADLYRRLEKTTLKTLKTRFVSDFLKRTPDDLLEIVPYLILGKVFPDWDERELGV
GEKLLIKAVSMATGVPEREIENSVRDTGDLGESVALALKKKKQKSFFSQPLTIKRVYGTF
VKIAEASGQGSQDRKLKYLANLFMDAQPEEGKYLARTVLGTMRTGVAEGLMRDAIASAFG
VKAELVERAYMLTSDFGYVAKVAKLEGNDGLSKVRIQVGKPIRPMLAQNAASVKEALVEM
GGKAAFEIKYDGARVQVHKDGDRVVIYSRRLENVTRSIPEVVDAVLGSVKAERAIVEGEL
VAVGEGGKPRPFQYVLRRFRRKYNIEEMIEKIPLELNLFDVLYVDGEGLIDTPFSERRKK
LEEIISPGERIRLAEQLVTTSADEAEEFYQRALELGHEGLMAKRLDSVYEPGNRGKKWLK
IKPTMEDLDLVIIGAEWGEGRRAHLLGSFLVAAFDPHSGEFVPVGKVGSGFTDEDLAEFT
RMLRPLIVREEGKLVEIEPKVVIQVTYQEIQKSPKYESGFALRFPRYVALREDKSPEEAD
TIERIAQLYEFQERFKAKR
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgccgaactcgctgacctttacagacgcctggaaaaaacgaccctcaagacc
cttaagacgaggttcgtctccgattttctgaagagaacccccgatgatctcctggagata
gtcccctacctcattctcggaaaggtcttcccagactgggatgagagagaactcggcgtt
ggcgagaagctcctcataaaggccgtctccatggcaaccggcgttccagagcgcgagata
gagaactcggtgagggacaccggtgatttgggagagagcgtcgctttagccctgaagaag
aaaaagcagaagagcttcttttcccagcccctcacgataaagcgcgtttacggcacgttc
gttaagatagcggaggcgagcgggcaggggagtcaggacagaaagctgaagtacctagcc
aacctcttcatggatgctcaaccagaggagggcaaatacctcgccagaacggttcttgga
acgatgagaaccggcgttgccgagggactcatgagggacgccatagcgagcgccttcggc
gtcaaggccgagctcgtcgagagggcctacatgctcaccagtgacttcggatatgtggcg
aaggtggccaagcttgagggcaacgatggcctctcaaaggtcaggattcaggtgggcaag
cccataagaccgatgcttgcccagaacgcggcgagcgtgaaggaagccctggtggaaatg
ggtgggaaggcggcgtttgagattaagtacgacggcgcgcgcgtccaggttcacaaggac
ggcgacagggttgttatctactcccgccggctggagaacgtgacaagatccatccccgag
gtcgttgacgctgtcctggggagcgtaaaagctgaaagggccatcgtggagggcgagctc
gttgccgtgggcgagggcgggaagcccaggcccttccagtacgtgcttaggcgcttcagg
agaaagtacaacatcgaggagatgatagagaaaatcccgctggagctgaacctcttcgac
gtcctctacgttgacggtgaggggctgatagacacgcccttctccgagcgcaggaagaag
ctggaggagataatttccccgggggagcggataaggctggcggagcagctggtaaccacc
agcgccgacgaggcggaggagttctatcagcgtgcccttgagctcggccacgaggggctg
atggcgaagcgcctggattcggtttacgagcccggaaacaggggcaagaagtggctcaag
ataaagcccacgatggaggaccttgacctcgtcataatcggcgccgaatggggtgaaggc
aggcgcgcacacctcctcggctccttcctggttgcggccttcgacccgcacagcggcgag
ttcgtcccggtcggaaaggtcgggagtggcttcaccgacgaggatctggccgagttcacc
aggatgctcaggcctctcatagtccgtgaagaaggaaagctcgtcgagatagagccgaag
gtcgttatccaggtcacctaccaggagatacagaagagtccgaagtacgagagcggcttt
gccctccgcttcccgcgctacgtggctttgagggaggacaagagtcccgaggaggccgac
actatcgagcgcatagcccagctctacgagttccaggagaggttcaaggcgaagcgctga

DBGET integrated database retrieval system