KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE0188Help
Entry
TTE0188           CDS       T00081                                 

Gene name
AceF
Definition
(GenBank) Dihydrolipoamide acyltransferases
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte00010  Glycolysis / Gluconeogenesis
tte00020  Citrate cycle (TCA cycle)
tte00620  Pyruvate metabolism
tte01100  Metabolic pathways
tte01110  Biosynthesis of secondary metabolites
tte01120  Microbial metabolism in diverse environments
tte01130  Biosynthesis of antibiotics
tte01200  Carbon metabolism
Module
tte_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTE0188 (AceF)
   00020 Citrate cycle (TCA cycle)
    TTE0188 (AceF)
   00620 Pyruvate metabolism
    TTE0188 (AceF)
Enzymes [BR:tte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TTE0188 (AceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N PYNP_C PTS_EIIA_1 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AAM23489
UniProt: Q8RD59
LinkDB All DBs
Position
191694..192938
Genome map
AA seq 414 aa AA seqDB search
MANVKLMPKLGMTMTAGKVVRWLKKEGEKVEAGEPLLEIETDKVTMEEEAGYTGTLLKIL
VREGEEVPINQPIAIIGGEGEDIEEILKTLKVSEGVEEEKKEEKIKVKIEEKPEEVKREE
ISKPRATPAARKIAREHGIDLSEVIGSGAHGRIHRKDVEEYIRKRTEIVPSQVTVEQKVE
KKEEIPSYRVIPFTGMRKIIAEKMQKSINTAPHFYVTMEVKMREILKLRETLNSKLKEDE
AKISLNTLLMKAAGIAIKDYPIFNSYVEEGQIILRNEINIGLAVALDEGLIVPVIREVDK
KGLKEIAREEKALIQKAREGKLTPDEYTGGSFTISNLGMFDVVRFAAIINPPEVAILAVG
KIREIPVVEEGQIEIEPIMEMTLSSDHRVIDGALAAKFLRRIKEILEDPLQFML
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgtaaaacttatgcctaagttaggtatgactatgacagctggcaaagtagtt
agatggttgaaaaaagaaggtgaaaaagtagaagcaggagagcctcttttggaaatagaa
actgacaaagttacaatggaagaagaagcaggttacacagggactcttttaaaaattctt
gtaagagagggagaagaagttcctataaatcagcctatagctataataggaggagaagga
gaagacatagaagagatactaaaaacgttaaaagtctctgagggagttgaagaagagaaa
aaagaagagaagataaaagtaaaaatagaggagaagccagaagaggtgaaaagagaagaa
atatctaaaccaagagctacaccggcagcaaggaaaatagcaagggaacatgggatagac
ctgtcagaagtaataggctctggagctcacggcagaattcataggaaagatgtagaagaa
tatattagaaagcgtactgaaatagtgccttcacaagtaacagtagaacaaaaagtagag
aaaaaagaagaaataccctcttatagagttattcctttcacaggaatgagaaaaataata
gcagaaaaaatgcaaaaaagtataaatacagctcctcatttttatgttactatggaagta
aagatgagagaaattttaaaattgagagagacattaaatagtaaattgaaagaggatgaa
gcaaaaattagccttaataccctgcttatgaaagctgctggaatagcaataaaagattat
ccgatatttaattcttatgtagaggaaggccagataattttaaggaatgaaataaatata
ggattggcggtagctttggatgaaggactaattgtacctgttataagggaagtagacaaa
aaaggattgaaagaaatagcaagggaagaaaaagcacttattcagaaagcaagagaagga
aaattaacacctgatgagtatactggaggaagtttcacaatctctaatttaggtatgttt
gatgtagtaagatttgcagctataattaatccaccggaagtagcaattttagctgtaggg
aagataagagagattcccgttgtagaagaaggacaaatcgaaatagagccgataatggaa
atgactttatcttcagatcatagagtaatagacggtgctctcgcggctaaatttttgaga
aggataaaagaaattttagaagatcccttacaatttatgttgtaa

DBGET integrated database retrieval system