KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE1813Help
Entry
TTE1813           CDS       T00081                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte00500  Starch and sucrose metabolism
tte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TTE1813
Enzymes [BR:tte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     TTE1813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 TPR_8
Motif
Other DBs
NCBI-ProteinID: AAM25005
UniProt: Q8R917
LinkDB All DBs
Position
complement(1760198..1762309)
Genome map
AA seq 703 aa AA seqDB search
MLKRIGILLIFIVIGVFVLSGCSDVSYVKVEHLDKTEASQGPGERDTWATAQKQGIGTAN
NDVSKVWFTLAQGALSEIYYPTIDRANSKFLKFIVTDGKTFVADETTDTVSKVEKINNRS
LAYRLVNIDKRGRYKITKEIFTDPRRNSVVMKVRFEALKGKMEDYKLYLVYDPHISNQGA
DNEGYVVKANGEYGFMACRNNVYSALMTDAKWGSYSVGYNGVNDPVSDLKKNKKMTYKFD
RAKGNIIEGIEIDLRDKTEFKTVLSFGESEEEALKTALSTLKDSYDRMLGIYIAEWNKYC
DGLKNFGGEADELYYTSLMFLKASEDKTNKGAFIASLSIPWGEGQGDENKGGYHLVWARD
LYHIANAFIAAKDIDSANRALDFLAMVVEKNGFMPQNTWINGDPYWNGIQMDEQADPIIL
AYHLKRYDLYEKLVKPLADFIVRVGPKTGQERWEEAGGYSPATMAAEVAGLVCAADIAKQ
NKDMERAKKYLETADKWQELIDKLTYTTKGPYGNGQYYIRIAGLPDPDADFLISIANGGG
VYDQKEIVDPSFLELVRLGVKAYDDPKILNTISVVDSLLKVNTPKGPSWYRYNHDGYGEP
AKGELYHGKGKGRLWPLLTGERGMYEIAAGKKADDYLEYMRNFANEGFVLSEQIWEDTGL
PTDSASPLNWAHAEYVVLFASNIEGKVVDMPQIVYKRYVLGER
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
gtgttgaagaggattggaattttgttgatttttatagtgattggagtttttgtcctttca
gggtgttctgatgtttcatacgtgaaggttgaacatttagataaaaccgaagcttctcaa
ggaccaggggagagagatacatgggcgacagctcaaaaacagggcattggcactgccaat
aatgatgtatcgaaagtatggtttactttagctcagggggccctttctgagatttactat
cctaccattgacagagccaacagcaagtttttaaaatttattgttactgatggcaaaact
tttgtggctgatgagacaactgacactgtaagcaaggtagagaagattaacaacaggtct
ttagcttacaggctagtgaatattgataaaagaggaaggtataaaattacaaaagagata
tttactgacccaagaaggaattctgttgtcatgaaggtgagatttgaagcgttaaaaggg
aaaatggaagattataaactttatcttgtgtacgaccctcatatttctaatcaaggagcg
gataatgaggggtatgttgtaaaagcgaatggtgaatacggatttatggcttgtagaaac
aatgtgtattcagccttaatgactgatgcgaaatgggggagctattctgtaggatataac
ggtgttaatgaccctgtgagcgatttaaagaaaaataagaaaatgacttacaagttcgat
agggctaaagggaatataattgagggtattgagattgatttaagagacaagacggaattt
aaaaccgttctttcctttggagaaagtgaggaagaggcgttaaagacggctcttagtact
ttaaaagacagttacgacaggatgcttgggatatatatagcagaatggaataaatactgc
gacgggcttaaaaactttggtggagaggcagacgagctttactataccagtttaatgttt
ttaaaggcgagtgaagataaaaccaacaaaggagcttttattgcctccctttcaattcca
tggggagaaggacagggggatgagaataaaggagggtatcacttagtttgggcaagagat
ttataccacatcgccaatgcttttattgcagctaaagatatagattcggctaatagggct
ttggattttctagctatggtggtagaaaaaaatggatttatgcctcaaaacacttggata
aacggagacccttactggaacgggattcagatggacgaacaggctgacccgataatcctg
gcatatcaccttaaaagatacgatttgtatgaaaaattggtaaaaccccttgctgatttt
atagtaagagtaggacctaagacaggacaagagaggtgggaggaagcgggagggtattct
cctgccactatggcagctgaagttgctggacttgtctgtgctgctgatattgcgaagcaa
aacaaagatatggaaagggcaaagaaatatctggagacagctgacaaatggcaagagttg
atagacaaactcacttatactacgaaaggaccttatggcaatgggcagtattatataaga
attgcaggtttaccggacccggatgccgactttttaataagcattgccaacggaggagga
gtgtatgaccagaaggagattgtagatccaagttttttagagcttgtaaggttaggagta
aaagcttatgatgacccaaagatattgaatactatttcggtagttgatagcctccttaaa
gtaaatactcctaaagggccttcgtggtacaggtacaatcatgatggctatggtgaaccc
gccaaaggagaactttatcatggcaaaggtaaaggcagattatggcctcttcttacagga
gagagagggatgtacgaaattgcagcagggaaaaaagcagatgactatctagagtatatg
agaaattttgctaatgaaggttttgtcttgtcagagcaaatttgggaagatacaggactt
cctacagattctgcttctcctctcaattgggctcatgcggaatatgtggtgctttttgca
tctaacatagaagggaaggtagttgatatgccacaaattgtatacaaaaggtatgtatta
ggggagagataa

DBGET integrated database retrieval system