KEGG   Caldanaerobacter subterraneus subsp. tengcongensis: TTE2334
Entry
TTE2334           CDS       T00081                                 

Gene name
PtsA
Definition
(GenBank) Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria)
  KO
K08483  phosphoenolpyruvate-protein phosphotransferase (PTS system enzyme I) [EC:2.7.3.9]
Organism
tte  Caldanaerobacter subterraneus subsp. tengcongensis
Pathway
tte02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:tte00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    TTE2334 (PtsA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tte02000]
    TTE2334 (PtsA)
Enzymes [BR:tte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     TTE2334 (PtsA)
Transporters [BR:tte02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    TTE2334 (PtsA)
SSDB
Motif
Pfam: PEP-utilizers_C PEP-utilisers_N PEP-utilizers HpcH_HpaI Lig_C
Other DBs
NCBI-ProteinID: AAM25475
UniProt: Q8R7R4
LinkDB
Structure
PDB: 
2XZ9 2BG5 2XZ7 5WOY

Position
complement(2216928..2218649)
AA seq 573 aa
MLKGVAASPGIAIGKAFLYTKEKVTINVEKIEESKVEEEIAKFRKALEVTQEEIEKIKEK
ALKEFGKEKAEIFEAHLMLASDPELIEGVENMIKTELVTADNAVNKVIEQNASVMESLND
EYLKERAVDLRDVGNRIIENLLGVKSVNLSDLEEEVVVIARDLTPSDTATMKKEMVLGFA
TDVGGRTSHTAIMARSLEIPAVVGLGNVTSQVKAGDLVIVDGLEGIVIVNPDEKTVEDYK
SKKESYEKKVEGLKQLKDLPAETPDGKKVMLAANIGTPKDVASALANGAEGVGLFRTEFL
YMDRNSLPSEEEQFEAYKEVVEKMGGRPVTIRTLDIGGDKELPYLDMPKEMNPFLGYRAI
RLCLDRPDIFKTQLRAILRASAYGNVQIMYPMISSVEEVRKANSILEEVKAELDREGVKY
DKEIKVGIMVEIPSAAVTADILAKEVDFFSIGTNDLTQYTLAVDRMNEHVKEYYQPFHPA
ILRLVKMVIDAAHKEGKFAAMCGEMAGDPLAAVILLGLGLDEFSMSATSIPEIKNIIRNV
EYEKAKEIAEKALNMSEAREIEKMMKDVIKDIG
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgttaaaaggagttgcggcatcgcctggaatagctataggcaaagcttttttgtatacc
aaagaaaaagtgacaataaatgtagaaaaaattgaagaatcgaaagtggaagaggaaatt
gcgaaatttagaaaggctttggaagttacacaggaggagatagagaaaatcaaggaaaaa
gctttgaaagaatttggaaaagaaaaagcagaaatttttgaagcacatttgatgctggca
agtgaccccgaacttattgaaggggtagaaaacatgattaaaacagaacttgtaacagct
gataacgcagttaataaggttatagagcaaaatgcttctgtgatggaaagtttgaatgac
gaatatttgaaagagagagctgttgatttaagggatgtgggcaatcgcataatagaaaat
ttattgggggtaaaaagtgtcaatctttctgaccttgaagaagaggttgtggtcattgcg
agagaccttactccttcagatacagctactatgaagaaagaaatggttttagggtttgct
acagacgtgggaggaaggacttcacatacagctataatggctcgctctttggaaatccct
gcagttgtgggcttaggcaatgtgacttctcaggtcaaagccggggacctcgttatagta
gacggattagaagggattgtaattgtaaatcctgatgaaaagactgtagaggactacaaa
agcaaaaaagagagctatgagaaaaaggtggaaggattaaagcagttaaaagatttgcct
gcagaaacacccgatggaaagaaagtcatgttggcagcaaatatagggactcccaaagat
gtagcctcagcgttagctaatggagcagagggagtagggctttttaggacagaatttttg
tacatggacagaaatagcctccctagtgaagaagagcaatttgaagcttataaggaagtt
gtagaaaaaatgggagggaggcctgtcactataaggacactggacataggaggagacaaa
gagcttccttaccttgatatgccaaaagagatgaatccttttttgggatacagggctata
aggctttgtttggatagaccggatattttcaagactcaattaagggctattttaagagca
agcgcttacggaaatgtacagataatgtatcccatgatttcgtctgtagaggaagtgaga
aaagcgaactctattttagaagaggtaaaagctgagcttgatagagaaggagtaaaatac
gataaggagataaaagtgggcataatggtagaaattccttctgcggctgtgacggcagat
attcttgctaaggaggtagatttctttagcatagggactaatgacctgacgcagtatacg
cttgcggtagacaggatgaacgaacatgtaaaagaatactatcagcccttccatccggct
attttgcgacttgtaaaaatggtgattgacgctgcccataaagaagggaagtttgccgct
atgtgcggggaaatggcaggagaccctcttgcggctgtcattcttttgggattaggcctt
gatgaattttccatgagcgcaacttccataccggagattaagaacataataagaaatgtg
gagtatgaaaaagcgaaagaaattgcagaaaaagccttaaacatgtcggaagcgagagag
atagaaaaaatgatgaaggacgtgataaaagatattggctaa

DBGET integrated database retrieval system