KEGG   Thermogutta terrifontis: THTE_2275Help
Entry
THTE_2275         CDS       T05034                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ttf  Thermogutta terrifontis
Pathway
ttf00010  Glycolysis / Gluconeogenesis
ttf00052  Galactose metabolism
ttf01100  Metabolic pathways
ttf01110  Biosynthesis of secondary metabolites
ttf01120  Microbial metabolism in diverse environments
ttf01130  Biosynthesis of antibiotics
Module
ttf_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ttf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THTE_2275
   00052 Galactose metabolism
    THTE_2275
Enzymes [BR:ttf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     THTE_2275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim DUF2992
Motif
Other DBs
NCBI-ProteinID: ASV74877
UniProt: A0A286RFZ5
LinkDB All DBs
Position
2358403..2359590
Genome map
AA seq 395 aa AA seqDB search
MLRETFHRARRNRGQCEKDSPIRFGGVLVSVVWLALGSCSGFASESSAMKVTREVFGKTP
EGQEVYLYQLENGRGLTVRAMSLGATLTAVEYPDREGKRENVTLYLETLEDYLRGHPCFG
SVCGRYANRIAKGRFELDGVVYQLATNNGPNHLHGGRVGFHQRLWQHEPVQGDGFVGVKF
TYVSPDGEENYPGTLTATVIYRITPDNRLEMEYFATTDKPTVVNLTNHAYWNLAGAGVGT
ILDHILQINADRYLPVDDTLIPLGEMAPVEGTPFDFRQPKPIGRDIEKTGGGYDHCFVLN
KSRPGELSFCARLEDPKTGRVMEVFTTQPGVQVYTANGLNGRLGAHGRTYPKFGAVCLET
QHFPDSPNRPQFPSTVLRPGGTYHELTVHHFSVAR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgggaaacatttcacagggcgaggcgtaatcgggggcaatgcgagaaagattca
cccattcggtttgggggcgtgctggtatcggttgtgtggcttgcgttggggtcgtgctcc
ggttttgcgagtgagagttcagcgatgaaagtgacaagagaagtttttggaaaaacgcct
gagggtcaggaagtttacctgtatcaactggagaatggacggggactgaccgtgcgggcg
atgtccctgggggctacactcacggcagtggaatacccggaccgtgaaggcaaacgggaa
aacgtgactctttatctggagacacttgaggattacctcagggggcacccgtgcttcggt
tccgtgtgtgggcgctacgcgaacagaattgcgaaagggcgatttgaattggatggtgtc
gtgtaccagttggcgacgaataacggtcccaatcatttacacggaggccgtgtgggattt
catcaacgactatggcagcatgagccggttcagggagacggatttgttggcgtgaagttc
acctatgtcagtcctgatggggaagaaaactatcctgggaccttaactgctacggtcatc
tatcgaatcactccagacaaccgtttggagatggagtacttcgcgacgactgacaagccc
acggttgtgaacctgacgaatcacgcttattggaatcttgcgggagcaggcgtggggact
attttggatcacattctgcagatcaacgcggatcgatatttgcccgtcgatgacacgttg
atccccctgggtgaaatggcccctgttgagggaacgcccttcgactttcgtcagcccaaa
ccgattgggcgggatatcgaaaaaacgggcgggggttatgatcactgttttgtcctcaat
aagtcccggccgggcgagctctcgttctgtgctcggcttgaggatccgaaaacgggccgt
gtgatggaggtgttcaccacgcagccgggcgttcaggtgtatacagccaacggcctgaac
ggccgcctgggcgcgcacggtcgaacctatcccaaattcggtgccgtgtgtctggaaact
cagcactttcctgactcgcctaatcggccgcaatttccatccacggtgctccgaccgggc
ggaacataccacgaactgactgtccaccacttttccgtggctaggtag

DBGET integrated database retrieval system