KEGG   Thermogutta terrifontis: THTE_3976Help
Entry
THTE_3976         CDS       T05034                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
ttf  Thermogutta terrifontis
Pathway
ttf00040  Pentose and glucuronate interconversions
ttf00051  Fructose and mannose metabolism
ttf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    THTE_3976
   00051 Fructose and mannose metabolism
    THTE_3976
Enzymes [BR:ttf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     THTE_3976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 TrkA_N URO-D NAD_binding_2 Shikimate_DH NAD_binding_7 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ASV76577
UniProt: A0A286RKW9
LinkDB All DBs
Position
complement(4267264..4268292)
Genome map
AA seq 342 aa AA seqDB search
MKALVLTAYKQLEIQDVPVPEPGAGEILVRVKACGICGSDVHGFDGSTGRRRPPIIMGHE
ASGVVAKTGEGVTQFRPGDRVTFDSTIYCGRCEFCRQGRVNLCDNRRVLGVSCAEYRRDG
AFAEYVVVPEHIAYRLPDSVSFEQAALIEPLSVALHAVDRGDLRLGETVLVIGGGMIGSL
IVQLVKVAGASDIVVLEPDPFRQELVRRAGATAVFSPHESWREELSKGTGGKRITLVFDA
VGIDETVRSAVENVEKGGRVVLVGNLAPQTTLLLQAVVTRELTLLGSCASQGDYPRCLDL
LARGVVTVDPLISAVAPLEEGPYWFDQLYQRKQPLLKVILRP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcgctcgtgctaaccgcttacaagcaattggaaatccaggatgttccagtgcct
gaacctggggcgggagagattctcgtgagagttaaggcctgtggcatttgtgggagcgat
gtccacgggttcgacggcagcacgggacgcaggcgaccgccgatcatcatgggtcacgaa
gcctcgggggttgtggcaaagaccggtgagggtgtgacgcaatttcgcccaggtgatcgg
gtgactttcgactccacaatttattgcggtcgctgtgagttttgccgacaggggcgggtt
aatctctgcgacaaccgccgtgttctgggagtgtcttgtgctgagtaccgacgggacggg
gcgttcgccgaatatgtggtcgttccggaacacatcgcctatcgtctcccagacagtgtt
tctttcgaacaggccgccttgatcgaaccgctttccgtggccctgcacgctgtggatcgc
ggggatcttcggcttggcgagacggtcctcgtgattggtggcggaatgatcggttcgctg
atcgtacaactggtcaaggttgccggagccagtgacattgtggtcctggaaccggatccg
tttcgccaggagcttgtgcgtcgggcgggagccactgccgttttttccccgcatgaatcc
tggcgggaagaactctccaaagggacgggaggcaaaaggatcacgctcgttttcgacgcg
gtgggcatcgacgagaccgtccgatcagcagtggaaaatgtggaaaaaggcggccgggtg
gttcttgttggcaatctggcccctcagactacacttctcctacaagcagtggttacccgc
gaactgacgctgctgggatcctgtgcatcacagggagattatccccgttgcctggattta
ttggcccggggagttgtaacagtggaccccctcatcagtgcagtcgcgcccctggaagag
ggcccttactggttcgaccagctctaccagagaaaacagcccctgctcaaagtgattctt
cgaccgtga

DBGET integrated database retrieval system