KEGG   Thermus thermophilus HB27: TT_C0168Help
Entry
TT_C0168          CDS       T00170                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
tth  Thermus thermophilus HB27
Pathway
tth00020  Citrate cycle (TCA cycle)
tth00270  Cysteine and methionine metabolism
tth00620  Pyruvate metabolism
tth00630  Glyoxylate and dicarboxylate metabolism
tth00680  Methane metabolism
tth00710  Carbon fixation in photosynthetic organisms
tth01100  Metabolic pathways
tth01110  Biosynthesis of secondary metabolites
tth01120  Microbial metabolism in diverse environments
tth01130  Biosynthesis of antibiotics
tth01200  Carbon metabolism
Module
tth_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tth_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tth_M00012  Glyoxylate cycle
tth_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TT_C0168
   00620 Pyruvate metabolism
    TT_C0168
   00630 Glyoxylate and dicarboxylate metabolism
    TT_C0168
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TT_C0168
   00680 Methane metabolism
    TT_C0168
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    TT_C0168
Enzymes [BR:tth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     TT_C0168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N DUF4885 Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: AAS80516
UniProt: P61977
LinkDB All DBs
Structure
PDB: 

Position
complement(149072..150055)
Genome map
AA seq 327 aa AA seqDB search
MKAPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDC
AFPLLAGLEATDDPKVAFKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVA
KKDVKVLVVGNPANTNALIAYKNAPGLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRR
MTVWGNHSSTMFPDLFHAEVDGRPALELVDMEWYEKVFIPTVAQRGAAIIQARGASSAAS
AANAAIEHIRDWALGTPEGDWVSMAVPSQGEYGIPEGIVYSFPVTAKDGAYRVVEGLEIN
EFARKRMEITAQELLDEMEQVKALGLI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggcacccgtacgcgtggcggttaccggagccgcgggacagatcggctacagcctc
ctcttccgcatcgccgcgggggagatgctgggcaaggaccagccggtgatcctccagctt
ttggagatcccccaggccatgaaggccctggaaggcgtggtcatggagctggaggactgc
gccttccccctgcttgcgggcctcgaggccaccgacgaccccaaggtggccttcaaggac
gccgactacgccctcctggtgggggcggccccccgcaaggcggggatggagcgccgggac
cttctgcaggtaaacggcaagatcttcaccgagcagggccgggccctggccgaggtggcc
aagaaggacgtcaaggtgctggtggtgggcaaccccgccaacaccaacgccctcatcgcc
tacaagaacgcccccggcctcaacccccggaacttcaccgccatgacccggctggaccac
aaccgggccaaggcccagctcgccaagaagaccgggacgggcgtggaccgcatccgccgc
atgacggtgtggggcaaccactcctccaccatgttccccgacctcttccacgccgaggtg
gacggcaggcccgccctggagctcgtggacatggagtggtacgagaaggtcttcatcccc
accgtggcccagcggggggcggccatcatccaggcccggggggccagcagcgccgccagc
gccgcgaacgccgccatagagcacatccgcgactgggccctgggcaccccggagggggac
tgggtctccatggccgtcccctcccaaggggagtacggcatccccgaaggcatcgtctac
tccttcccggtgacagccaaggacggagcgtaccgggtcgtggaaggcctggagatcaac
gagttcgcccgcaagcgcatggagatcacggcccaggaactcctggacgagatggagcag
gtgaaggccctgggcctcatctga

DBGET integrated database retrieval system