KEGG   Thermus thermophilus HB27: TT_C0201Help
Entry
TT_C0201          CDS       T00170                                 

Definition
(GenBank) threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
tth  Thermus thermophilus HB27
Pathway
tth00260  Glycine, serine and threonine metabolism
tth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tth00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TT_C0201
Enzymes [BR:tth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     TT_C0201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C FAD_binding_3 HI0933_like ADH_N_2 ORF11CD3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AAS80549
UniProt: Q72L62
LinkDB All DBs
Structure
PDB: 

Position
187529..188560
Genome map
AA seq 343 aa AA seqDB search
MRALAKLAPEEGLTLVDRPVPEPGPGEILVRVEAASICGTDLHIWKWDAWARGRIRPPLV
TGHEFSGVVEAVGPGVKRPQVGDHVSLESHVVCHACPACRTGNYHVCLNTKILGVDRDGG
FAEYVVVPAENAWVNPKDLPFEVAAILEPFGNAVHTVYAGSGVSGKSVLITGAGPIGLMA
AMVARASGAGPILVSDPNPYRLAFARPYADRLVNPLEEDLLEVVRRVTGSGVEVLLEFSG
NEAAIHQGLMALIPGGEARILGIPSDPIRFDLAGELVMRGITAFGIAGRRLWQTWMQGTA
LVYSGRVDLSPLITHRLPLSRYREAFGLLASGQAVKVILDPKA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctttggccaagctggccccggaggagggcctaaccctggtggaccgccccgtg
cccgagccgggccccggggagatcctggtgcgggtggaggcggcgagcatctgcggcacc
gacctccacatctggaagtgggacgcctgggcccgggggaggatcaggccccccctcgtc
accgggcacgagttcagcggggtggtggaggccgtgggccccggggtgaagcgcccccag
gtgggggaccacgtgagcctagaaagccacgtggtctgccacgcctgccccgcctgccgc
acggggaactaccacgtctgcttgaacacaaagatcctcggcgtggaccgggacggcggc
ttcgccgagtacgtggtggtgccggcggagaacgcctgggtgaaccccaaggaccttccc
tttgaggtggcggccatcctcgagcccttcggcaacgccgtgcacaccgtctacgcggga
agcggggtctcggggaagagcgtcctcatcacgggggcggggcccatcggcctcatggcg
gccatggtggcccgggcgagcggggcggggcccatcctcgtctccgacccgaacccctac
cgcctggccttcgccaggccctacgccgaccggctggtgaaccccttggaggaggacctc
ctggaggtggtgcgccgggtgacgggaagcggggtggaggtgcttttggagttttctggg
aacgaggccgccatccaccagggcctcatggccctcatccccgggggggaggcgaggatc
ttggggatcccttccgaccccatccgctttgacctcgccggggagctcgtgatgcggggg
atcaccgccttcggcatcgccgggcggaggctctggcagacctggatgcagggcaccgcc
ttggtctactcgggtagggtggacctaagccccctcatcacccaccgcctccccttgagc
cgctaccgggaggccttcggcctcctcgcctcgggccaggcggtgaaggtgatcctggac
ccgaaggcctaa

DBGET integrated database retrieval system