KEGG   Thermus thermophilus HB27: TT_C0260Help
Entry
TT_C0260          CDS       T00170                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tth  Thermus thermophilus HB27
Pathway
tth00620  Pyruvate metabolism
tth00680  Methane metabolism
tth00710  Carbon fixation in photosynthetic organisms
tth01100  Metabolic pathways
tth01120  Microbial metabolism in diverse environments
tth01200  Carbon metabolism
Module
tth_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TT_C0260
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TT_C0260
   00680 Methane metabolism
    TT_C0260
Enzymes [BR:tth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TT_C0260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF4350
Motif
Other DBs
NCBI-ProteinID: AAS80608
UniProt: Q72L05
LinkDB All DBs
Position
250325..252901
Genome map
AA seq 858 aa AA seqDB search
MSQDPFALLKAEVDLLGRLLGEAIRTLSGERFFALVEEVRALAKARRQGDEAAGEALLAR
VEGLSTEEAEALVRAFTHYFHLVNLAEERHRVRVNRLRAQAETLESPRPEGFLALAKALK
ERGLSLEEAEAHLNRLELLLTFTAHPTETRRRTLRHHLEALQRELEAGDRERLAARVALL
YGTEEVRKARPTVEDEIKGGLYYLPTTLWEAVPRVVAGLEAALERVYGRRPRLKSPVRFR
SWIGGDRDGNPFVTPEVTAFAGRYAREVARRRFLEALEDLVRDLSLAEARVPVPREVRER
GEGVERFMGEPYRRYFAALYRALEREEATTEGLLAALKAAERGLREVGLGRVAEAFLDPL
EARLSAFGLELAPLDLREESGRLLEAAAELLRVGGVHPDFLALPQEERERLLTEELKTAR
PLLPVGEAPEGEALRVALGALKAWRDKGAHVVSMTHHPEDLLAVFLLAREVGLYRPGRPL
PFDVVPLFETLEDLRRAPGVLRRLLENPVFLAHARGRGGVEVMIGYSDSNKDAGFLMANL
ALYEAQEALSRVGEEVGLPVYFFHGRGTSTARGGGPAGRAIASLPPRSVGRRIRLTEQGE
ALADRYSHPDLAVRHLEQMLYHFALAALGPGQEPEARWREALAQAAEESTRRYRALLQEE
GFFDFFEAFTPIREIGELPIASRPVYRRGRVRDIRDLRAIPWVMAWTQVRVLLPGWYGLS
ALEELPLDLLREMYRGWPFFASTLEAAAMALAKADMGVARLYLRLVPEPLRFFYRRLAEE
HARTVALLEAVFQAPLLHNQRTLERQIRLRNPYVDPINIVQVELLRRYRAPGGKEDEALR
RALLLSILGVAAGLRNAG
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
gtgagccaggaccccttcgccctcctcaaggccgaggtggacctcctcggccgcctcctc
ggggaggccatccggaccctctccggggagcgcttcttcgccctggtggaggaggtgcgg
gccctcgccaaggcccgccgccagggggacgaggcggcgggagaggcgcttctggcccgg
gtggaggggctttccaccgaggaggccgaggccttggtgcgggccttcacccactacttc
cacctggtgaacctggcggaggagcggcaccgggtgcgggtgaaccgcctaagggcccag
gccgagaccctggaaagccccaggcccgagggcttcctggccctggccaaggcgcttaag
gagcgggggctttccctggaggaggccgaggcccacctgaaccgcctggagctcctcctc
accttcaccgcccaccccacggagacccggcgccgcaccctgcgccaccacctcgaggcc
ctgcagagggagctggaggcgggggatagggaaaggctcgccgcccgggtggccctcctc
tacggcacggaggaggtgcgcaaggcccgccccacggtggaggacgagatcaaggggggg
ctttactacctgcccaccaccctgtgggaggccgtgccccgggtggtggcgggcctcgag
gccgccctggagagggtctacgggcgaaggccccgcctgaaaagccccgtgcgctttagg
agctggatcggcggcgaccgggacggcaaccccttcgtcacccccgaggtcaccgccttc
gccgggcgctacgcccgggaggtggcccggaggcggtttttggaggccctcgaggacctc
gtgcgcgacctctccctggccgaggcccgcgttcccgtcccccgggaggtgcgggagagg
ggagagggggtggagcgcttcatgggggagccctaccgccgctacttcgccgccctgtac
cgggccttggagcgggaggaggccaccacggaagggcttctcgccgccctgaaggcggcg
gagcgggggcttagggaggtggggcttggccgggtggcggaggccttcttggaccccttg
gaggcccgcctttccgccttcggcctggagctcgcccctctagacctcagggaggagtcg
gggaggctcctcgaggccgcggccgagctcctccgggtgggcggggtccaccccgacttc
ctcgcccttccccaggaggagcgggagcgcctcctcaccgaggagctcaagaccgcccgc
cccctcctccccgtgggggaggccccggagggggaggccctaagggtagccctgggggcc
ctgaaggcctggcgggacaagggggcccacgtggtctccatgacccaccacccggaggac
ctcctcgccgtcttcctcctcgcccgggaggtggggctctaccgccccggccggcccctg
ccctttgacgtggtccccctctttgagaccctggaggacctgaggcgggcccccggggtg
ctccgccgccttttggagaaccccgtcttcctggcccacgcccgggggcggggcggcgtg
gaggtgatgatcggctactccgactccaacaaggacgcgggcttccttatggctaacctc
gccctctacgaggcccaggaggccttgagccgggtgggggaggaggtggggcttcccgtc
tacttcttccacggccgggggacctccacggcgaggggtgggggccccgcgggccgggcc
atcgcgagcctcccgccccggagcgtggggcggaggatccgcctcacggagcagggggag
gccctggcggaccggtacagccaccccgacctcgccgtgcgccacctggagcagatgctg
taccacttcgccttggcggccctgggccccggccaggagcccgaggcgcgctggcgggag
gccctggcccaggcggcggaggagagcacccgccgctaccgcgccctcctccaggaggag
gggttctttgacttctttgaggccttcacccccatccgggagatcggggagcttcccatc
gccagccgccccgtgtaccgccgggggcgggtacgggacatccgggacctccgggccatc
ccttgggtcatggcctggacccaggtccgggttctcctgcccggctggtacggcctctcc
gctctggaagagcttcctttggaccttctccgggagatgtaccggggctggcccttcttc
gcctccaccctggaggccgcggccatggccctcgccaaggcggatatgggggtggcccgc
ctctatctgcgcctggtccccgagcccctgcggttcttctaccgccggctcgccgaggaa
cacgcccgcaccgtggcccttttggaggccgtcttccaggcccccctcctccacaaccag
aggaccctggagcggcagatccggctccgtaacccctacgtggaccccatcaacatcgtc
caggtggagcttctccgccgctatcgggctcccgggggcaaggaggacgaggccctgagg
cgggcccttctcctctccatcctgggcgtggcggcgggcctcaggaacgcgggttga

DBGET integrated database retrieval system