KEGG   Thermus thermophilus HB27: TT_C1723Help
Entry
TT_C1723          CDS       T00170                                 

Gene name
pstB
Definition
(GenBank) phosphate transport ATP-binding protein pstB
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
tth  Thermus thermophilus HB27
Pathway
tth02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:tth00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    TT_C1723 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tth02000]
    TT_C1723 (pstB)
Enzymes [BR:tth01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     TT_C1723 (pstB)
Transporters [BR:tth02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    TT_C1723 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 RsgA_GTPase AAA_29 AAA_23 AAA_16 oligo_HPY AAA_33 AAA_15 Rad17 ABC_ATPase AAA_28 AAA_18 AAA_25 ATPase_2 Adeno_IVa2 AAA_30 ATP-synt_ab AAA_24 NACHT NB-ARC PRK AAA_14 MMR_HSR1 Viral_helicase1 AAA_5 ATPase AAA Glyco_hydro_2 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AAS82065
UniProt: Q72GX5
LinkDB All DBs
Position
complement(1639577..1640392)
Genome map
AA seq 271 aa AA seqDB search
MVSLEQLREHETVRTDPVPESQALVDVRQLSLWYGTKQALYDISVRFPKNQVTAIIGPSG
CGKSTLLRSLNRMNDLVPGVRVKGEVLYEGVNIYDPRVDPVAVRRHIGMVFQKPNPFPKT
IFENVAFGLRLMGVKGSELEDRVVEALKRAALWEEVKDRFKKESGLRLSGGQQQRLCIAR
AIAVEPPLLLMDEPTSALDPIATQAIEDLILELKERYTVVIVTHNMQQAARVSDRTLFMH
LGVLVEEGPTEVIFTKPKHPYTEAYITGRFG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggtgagcctggaacagctcagagaacacgagaccgtgcgcaccgacccggtgccggag
agccaggccttggtggacgtccgccagctaagcctttggtacgggacgaaacaggccctt
tacgacatctccgtgcgctttcccaaaaaccaggtcacggccatcatcggcccctcgggg
tgcgggaagagcaccctcctccgctccctgaaccgcatgaacgacctggtgcccggggtg
cgggtgaagggagaggtcctctacgaaggggtgaacatctacgacccccgggtggacccg
gtggcggtgcggcgccacatcggcatggtcttccagaagcccaaccccttccccaagacc
atctttgagaacgtggccttcggcctccggctcatgggggtgaagggcagcgagctggag
gaccgggtggtggaggccttgaagcgggccgccctatgggaagaggtcaaggaccgcttc
aagaaggaaagcggcctgaggctttccggcggccagcagcagaggctctgcatcgcccgg
gccatcgccgtggagccgcccctcctcctcatggacgaacccacgagcgccttggacccc
atcgctacccaggccattgaagacctgatcctagagctgaaggagcgctacacggtcgtc
atcgtcacgcacaacatgcaacaggctgcccgggtctccgaccgcacccttttcatgcac
ctaggggtcctggtggaggaaggccccaccgaggtgatcttcaccaagcccaagcaccct
tacaccgaggcctacatcaccgggcgcttcggctaa

DBGET integrated database retrieval system