KEGG   Thermus thermophilus HB27: TT_C1754Help
Entry
TT_C1754          CDS       T00170                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tth  Thermus thermophilus HB27
Pathway
tth00010  Glycolysis / Gluconeogenesis
tth00020  Citrate cycle (TCA cycle)
tth00620  Pyruvate metabolism
tth01100  Metabolic pathways
tth01110  Biosynthesis of secondary metabolites
tth01120  Microbial metabolism in diverse environments
tth01130  Biosynthesis of antibiotics
tth01200  Carbon metabolism
Module
tth_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TT_C1754
   00020 Citrate cycle (TCA cycle)
    TT_C1754
   00620 Pyruvate metabolism
    TT_C1754
Enzymes [BR:tth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TT_C1754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AAS82096
UniProt: Q72GU4
LinkDB All DBs
Structure
PDB: 

Position
complement(1664234..1665589)
Genome map
AA seq 451 aa AA seqDB search
MPKEILMPELAESVVEGEILKWLVEEGDYLKKDQPFVEVMTDKVTVELPSPYEGVLLKKL
AKEGEVVKVHAPIALIAEPGEAVEGVKEPPPVQAVEERSIVEPGLPAKEEKEDLSLFKPD
PTQVAVKNPFLSGEKPQEGARPGRVLAVPAARKLARELGIPIEEVPGSGPLGRVRVEDVR
AYAERRKAPPERPEEGPQVLPAGFPPPPKYAPPKGYEHLEERVPLRGIRRTIAQGLWQSH
LYTVRTLNVDEADLTELVRLRERLKPQAEAQGVKLTYLPFIVKAVVRALKKFPMLNTSLD
EERQEIVYKRYYHIGLAVATERGLIVPVVRDADRKSVLELAQEIAELSQKAREGRLAPEE
VTGSTFTITNIGSVGATLSFPIIHLPDAAILGVHSIRKRPWVMPDGSIRPRDIMFLSLSF
DHRLVDGAEAAMFTREVIRLLENPDLLLLEM
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaggaaatcctcatgcccgagctcgccgaaagcgtggtggaaggcgagattctg
aagtggctcgtggaggaaggggactacctgaagaaggaccagcccttcgtggaggtcatg
accgacaaggttacggtggagctgccctccccttacgagggggtgctcctgaagaagctg
gccaaggaaggggaggtggtcaaggtccacgcccccatcgccctcatcgccgagcccggc
gaggcggtggagggcgtgaaggagccccccccggtgcaggcggtggaggagcgctccatc
gtggagccgggcctgcccgcgaaggaggagaaggaggacctctccctcttcaagccggac
cccacgcaggtggcggtgaaaaaccccttcctctccggggaaaagccccaggagggggcg
aggccggggcgggtcctcgccgtccccgccgcccggaagctcgcccgggagctcgggatc
cccattgaggaggtgccgggctcggggcctttgggcagggtccgggtggaggacgtccgg
gcctacgccgagcggaggaaagcccctcccgaaaggcccgaggaggggccccaggtgctt
cctgccggcttcccgcccccgcccaagtacgccccgcccaaggggtacgagcacctggag
gagcgggtgcctctaaggggcatccgccgcaccatcgcccaggggctctggcagagccac
ctctacacggtgcgcaccctcaacgtggacgaggccgacctcacggagctcgtgcgcctg
cgcgagcgcctcaagccccaggccgaggcccagggggtcaagctcacctacctgcccttc
atcgtcaaggcagtggtgcgggccctgaagaagttccccatgctgaacaccagcctggac
gaggaaaggcaggagatcgtctacaagcgctactaccacatcggcctcgccgtggccacg
gaaaggggcctcatcgtccccgtggtgcgggatgcggaccggaagagcgtcttggagctc
gcccaggagatcgccgagctctcccagaaggcgcgggaaggccgcctcgccccggaggag
gttacggggtccaccttcaccatcaccaacatcggctccgtgggggccaccttgagcttc
cccatcatccacctgccggacgcggccatcctcggcgtgcactccataaggaagcgcccc
tgggtcatgccggacggttccataaggccgcgggacatcatgttcctctccctctccttt
gaccaccgcctggtggacggggccgaggcggccatgttcacccgggaggtcatcaggctc
ttggaaaaccccgacctgctccttctggaaatgtag

DBGET integrated database retrieval system