KEGG   Thioalkalivibrio paradoxus: THITH_06325Help
Entry
THITH_06325       CDS       T03590                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
tti  Thioalkalivibrio paradoxus
Pathway
tti00550  Peptidoglycan biosynthesis
tti01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tti00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    THITH_06325
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tti01002]
    THITH_06325
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tti01011]
    THITH_06325
Enzymes [BR:tti01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     THITH_06325
Peptidases [BR:tti01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   THITH_06325
Peptidoglycan biosynthesis and degradation proteins [BR:tti01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   THITH_06325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AHE97935
UniProt: W0DM25
LinkDB All DBs
Position
1317701..1318930
Genome map
AA seq 409 aa AA seqDB search
MNKRLLILLGSLFLIVASVPQLSGQPLPTPGPATASLGVIPQPPSDITAESYILVDFDSG
LPLASRDPDMEREPASLTKLMTAYVVFSEIQAGKIALDEKVTISERAWRTGMDGASRMFI
EVGERVAVEDLLRGMIVQSGNDASTALAELVAGSEGAFVDLMNAQARALGMQRSYFANPH
GLPGHEAQYTTPADMARLARALIRDFPELYRYYSEQSFTYNDIRQSNRNLLLWRDESFDG
LKTGWTSAAGYNLVSSAKRNDRRLIAVVMGIDAPNHQRGGILRANESQALINWGMRFFES
RKLFEGGTVLNEPRVYKGASTTLEAGLAEPFWVVLPQGQGDRLQATMELHGPHMAPIEAG
ATVGEVRVTLGGETLARQPLVALETVESGGVFRWLWDSAALAIRSAWPL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcgtctactgatcctgctcggttccctgttcctgatcgtcgcgtcggtcccg
cagctgagcggacagccactgcccactcccggtccggcaaccgcctcgctgggggtcatc
ccgcagcccccgtcggacatcaccgccgagagctacatcctggtcgacttcgactccggc
ctgccgctcgcgtcccgcgatccggacatggagcgcgagcccgcaagcctgaccaagctg
atgaccgcgtacgtggtgttcagcgaaatccaggccggcaagatcgctctggacgagaaa
gtcacgatcagcgagcgcgcctggcgtaccggcatggacggcgcgtcgcgcatgttcatc
gaggtcggcgaacgcgtcgcggtcgaggatctgctccggggcatgatcgtccagtcgggc
aacgacgcatcgaccgcgctggcggaactcgtggcaggctccgagggcgcgttcgtggac
ctgatgaacgcccaggcccgtgcgctgggcatgcagcgttcgtacttcgcgaacccgcac
gggcttccgggtcacgaggcgcagtacaccactcccgcggacatggcgcgcctggcccgc
gcattgatccgcgatttcccggagctctaccgctactacagcgagcagtcgttcacctac
aacgacatccggcagtcgaaccgcaacctgctgctgtggcgcgacgaaagcttcgatggc
ctgaagaccggctggacctcggccgccggctacaatctcgtgtcctcggccaagcgcaac
gatcgccggctgattgcggtggtgatggggatcgacgcgcccaatcaccagcgcggtggc
atcctgcgtgcgaacgaatcgcaggcgctgatcaactggggcatgcgtttcttcgagtcg
cgcaaattgttcgaaggcggcaccgtgctgaacgagccgcgggtgtacaagggtgcgagc
accaccctggaagccggcctggccgagccgttctgggtcgtgctgccgcagggccagggc
gatcggctgcaggcgacgatggaactgcacggcccgcacatggccccgatcgaggccggc
gccaccgtgggcgaggtacgcgtgaccctcggcggcgagacgctggctcggcagccgctg
gtggcgctcgaaacggtcgagtccggcggggtcttccgctggctgtgggacagcgctgcg
cttgcgatccgttcggcctggcctctgtga

DBGET integrated database retrieval system