KEGG   Thioalkalivibrio paradoxus: THITH_07575
Entry
THITH_07575       CDS       T03590                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
tti  Thioalkalivibrio paradoxus
Pathway
tti00620  Pyruvate metabolism
tti01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    THITH_07575
Enzymes [BR:tti01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     THITH_07575
SSDB
Other DBs
NCBI-ProteinID: AHE98147
UniProt: W0DLL4
LinkDB
Position
complement(1586752..1590243)
AA seq 1163 aa
MDLVRMLGLGASPADPEAERRKLQLYINLKLASSGQPTFLSGDMAEFLDTAQDLLKSYRE
KNRLLSQHHCPADRRIQDFLERYLDGFDPVPRLPTQSFILDRHGVARELSLPMDGDEFHS
EILSSYRVRQGVLHNPDKDRRTTEGSFHVAEGGLPIPGDKKAVPREAFGRLVAAALNPPD
DLLTLPFTASARRPARMFVSLLLRPTVCPEIPHQAAEKTMEIRFFAPGNLVSNLDFVESI
FGNGGNPYLPEFDAALDVEHWTGHTGCVILAPHLIHCTKKELGLPHRDQASERQRQDGMC
WSEEHELYNNGQAFKITARDESGVIVTVVADNYYGYCKKEVKTQISFAANLYGLAEEEHA
GGALAFRRRNHGEEYGVDSRTREPGYTFDEMVERYGSVMDLQPEGYAIDRHHPEVIYVPQ
DLRMSLNAQTITWEHQGQTQTIRLEPGKIYMQPNGYKVEMLRHPGAPSWRLVGTDPEGTF
CHKPCTVSGGGKSEISKSIEDAVIFGPLFVDDLHKDLDRVQEIFDRDYSARFRAGFEGED
RDPSRKPLSPQRSLGSVIKLLTPSKSYTDEFNQWLEAIPPRILALVYLIKRFYRQEWGND
WRHHLSVDEVDGAPGHELKLHGRRIIATYLRLGFDTEGKWRTFKVRQDYIAAEKVQMEDD
ISASVVVPAQCLTHPPREEARQRSHKLVKNCEYRLFQRPDEAIHPGFDRQTEADLAQPGN
FLANYEPLRGDALSAVTHDVLTLHDFTAPMRNLLLEAEAADGYVVSSAHPRLVDGKPSKN
PRYLQTRPDLVQPVRRYVAEMGARFHRKLPLAEPLCLPVDAVLTGRRNNPPEPGIRPLAV
YNPIHYQELPELFMDFVCSLTGKSPSTTGAGSEGALTKGPFNALRPTADLNNALVSFILT
GYAGFSSSAGHIGPQLRVDHDVSLLIPEIWTRLHPQEREPGFMIENGYLEPLADFEHKGQ
KVLASRLGYRITDRFVHDFLGKIFDNPSAVFTDAILRPETQDLDVFADGVANIVEAQQRV
ARRYLEDGCLDDACPPLRALLHIMAEGHFQGRDAHHPEVRAMFTRDSLLASDWYRERLEV
KQRRDAALWQRHADNLQHFLELESHADEAERLDVAGRLQTARATLARVQSPDYLESLVGT
IGADPLGPARQTLELPEPQRQVA
NT seq 3492 nt   +upstreamnt  +downstreamnt
atggacctggtacgcatgctcggcctgggcgcaagcccggccgatcccgaggcggagcgc
cggaagctccagctctacatcaacctgaaactcgcgtcctcggggcagccgacgttcctg
agcggggacatggcggagtttctggacaccgcccaggatctgctgaagtcctaccgcgag
aagaaccggctgctgtcgcagcatcactgcccggcagaccggcgcatccaggactttctg
gagcgctacctggacgggttcgatccggtgccccgcctgccaacgcagagtttcattctg
gaccgccacggcgtcgcccgcgaactgtcgctgccaatggacggcgacgagttccattcc
gagatcctgtcgagctaccgcgtgcgccagggcgtgctgcacaaccccgacaaggatcgg
cgaaccaccgaggggtcgttccacgtcgccgagggcggactgccgatccccggagacaag
aaggccgtgccgcgcgaggcgttcgggcgcctggtcgcggcggcactgaatccgccggac
gatctgctcacgctgccgttcaccgccagcgcccggcgacccgcgcggatgttcgtgtcg
ctgctgctgcgcccgaccgtctgccccgagattccgcaccaggccgccgagaagacgatg
gagatccggttcttcgcccccggcaacctggtcagcaacctggacttcgtcgagagcatc
ttcggcaatggcggcaatccgtacctgcccgagttcgacgccgcgctcgatgtcgaacac
tggaccggccataccggctgcgtgatcctcgcaccgcacctgatccactgcaccaagaag
gaactgggcctgccgcaccgggaccaggccagcgagcgccaacgccaggatggcatgtgc
tggagcgaggaacatgagctctacaacaacggtcaggccttcaagatcaccgcgcgtgac
gagagcggcgtgatcgtgaccgtggtggcggacaactactacgggtactgcaagaaggaa
gtgaaaacccagatcagcttcgccgcgaacctctacggcctggccgaggaagagcacgcc
ggtggcgcactcgcgttccggcgccgcaatcacggcgaggaatacggcgtcgacagccgg
acccgcgaacccggctacaccttcgacgagatggtcgaacgctatggatcggtgatggat
ctgcagccggaaggctacgccatcgatcggcatcaccccgaagtcatctacgtaccccag
gatctgcgcatgtcgctgaacgcgcagaccatcacctgggaacaccaggggcagacgcaa
accatccggctggagccgggcaagatctacatgcagccgaacggctacaaggtggagatg
ctgcgccacccgggagcgccctcctggcgcctggtcggtaccgacccggaaggcaccttc
tgccacaagccttgcacggtttccggcggcggcaagagcgagatctccaagtcgatcgag
gatgcggtgatcttcgggccgctgttcgtcgacgacctgcacaaggatctcgaccgggtc
caggagatcttcgaccgcgactacagcgcccgcttccgcgccggcttcgaaggcgaggat
cgcgacccgtcgcgcaagccgctgagcccgcagcgcagccttggctcggtgatcaagttg
ctgaccccgtcgaagagctataccgacgagttcaaccagtggctcgaggcgatccctccg
cgcattctcgcactggtgtacctgatcaagcgcttctatcgccaggaatggggtaacgac
tggcgccaccacctgtcggtcgacgaagtggatggcgcccccggccacgaactgaagctg
cacgggcgccgcatcatcgccacctatctgcgcctgggcttcgacaccgagggcaaatgg
cgcacgttcaaggtccgccaggattacatcgcggcggaaaaggtgcagatggaagacgac
atcagcgccagcgtggtcgtgcccgcgcagtgcctcacgcatccgcctcgggaagaagcc
cggcagcgcagccacaagctggtgaagaactgcgagtatcggctgttccagcgcccggac
gaggcgattcacccgggcttcgatcgccagaccgaggccgacctggcacaaccggggaac
ttcctcgccaactacgaaccactgcgtggcgatgcgctgtcggcggttacccacgacgta
ctgacgctgcacgacttcaccgcgccgatgcgcaacctgctgctcgaggccgaggccgcc
gacggctatgtggtgtcgtcggcccatccgcggctggtcgacggcaagccgtcgaaaaac
ccgcgctacctgcagacgcgcccggacctggtccagccggtccggcgttatgtcgccgaa
atgggcgcgcgcttccaccgcaagctaccgctcgccgaaccgctgtgcctaccggtggac
gcagtgctgaccggccggcgcaacaatcccccggagccggggatccgtccgctcgcggtg
tacaacccgatccattaccaggagctgcccgagctgttcatggatttcgtctgctcgctg
accggcaagtccccgtcgacgaccggcgccggcagcgagggcgcgctgaccaagggcccg
ttcaacgcgctgcgcccgaccgcggacctgaacaatgcactggtgtcgttcatcctgacc
ggctacgccggcttctcgagttcggccggacacatcggcccgcagctgcgcgtcgatcac
gacgtcagcctgctgattccagagatctggacccgcttgcatccgcaggagcgcgagccc
ggcttcatgatcgagaacggctacctggaacccctggcggatttcgaacacaaggggcag
aaggtgctggccagccgcctcggctaccggatcaccgaccgcttcgtgcacgacttcctg
ggcaagatcttcgataacccgagcgcggtgttcaccgacgcgatcctgcgtccggaaacg
caggatctcgacgtgttcgccgatggcgtggccaatatcgtcgaagcacagcagcgggtc
gcacggcgctacctcgaagacggctgcctggacgatgcctgcccgccgctcagggcgctg
ctgcacatcatggcggaggggcacttccagggccgcgacgcgcaccacccggaggttcgg
gcgatgttcacgcgcgactccctgctcgcgtcggactggtaccgcgagcgcctggaagtg
aaacagcgccgcgacgcggccctgtggcaacggcacgccgacaacctgcagcacttcctg
gaactcgaaagtcacgccgacgaggcggagcgtctcgacgtcgccggccgcctgcagacg
gcccgcgcaacgcttgcacgggtgcaaagccccgactacctggagagcctggtcggcacc
atcggcgcggaccctctcggccccgcgcgccaaacgctggaactgcccgagccgcagcgc
caggtcgcctga

DBGET integrated database retrieval system