KEGG   Thioalkalivibrio paradoxus: THITH_11795Help
Entry
THITH_11795       CDS       T03590                                 

Gene name
pstB
Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
tti  Thioalkalivibrio paradoxus
Pathway
tti02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:tti00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    THITH_11795 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tti02000]
    THITH_11795 (pstB)
Enzymes [BR:tti01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     THITH_11795 (pstB)
Transporters [BR:tti02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    THITH_11795 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_22 AAA_16 AAA_29 AAA_23 ABC_ATPase AAA_15 AAA_25 Rad17 AAA_30 AAA_33 ATPase_2 NB-ARC AAA_28 Tubulin
Motif
Other DBs
NCBI-ProteinID: AHE98816
UniProt: W0DK43
LinkDB All DBs
Position
complement(2547816..2548655)
Genome map
AA seq 279 aa AA seqDB search
MSQRSPAATSMASGLFEGTTRTVRSLADEDIAVTVENLDLYYGDSQALKQITMQIPAKRV
TAFIGPSGCGKSTLLRCFNRMNDLVDGCRIEGAINLHGENIYRRGTDVAELRRRVGMVFQ
KPNPFPKTIYENVAYGLRLQGVKNKRVLDEVVERSIKAVGLWDEVKDRLQGNAFGLSGGQ
QQRLVIARAIAIEPEVILLDEPTSALDPISTAKIEELVEELKQQYTIMIVTHNMQQAARV
SDYTAYMYLGELVEYADTMHLFTNPSQKATEDYITGRYG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgagccagagaagccccgccgcgaccagcatggcctccggcctgttcgagggtacgacc
cgtacggtccgttcgctggccgacgaggacatcgcggtcacggttgaaaacctggacctg
tattacggcgacagccaggcgctgaaacagatcacgatgcagatcccggcgaaacgggtt
accgcgttcatcgggccctcgggttgcggcaagtcgaccctgctgcgctgtttcaatcgc
atgaacgatctggtcgatggctgccggatcgagggcgcgatcaacctgcacggtgaaaac
atctaccgtcggggcacggatgtcgcggagctgcgccggcgcgtcgggatggtgttccag
aagccgaacccgttcccgaaaacgatctacgaaaacgtcgcctacggtctgcgcctgcag
ggcgtgaaaaacaagcgtgtgctggacgaagtcgtcgagcgctcgatcaaggccgtgggt
ctttgggacgaggtgaaggaccgtctgcagggcaacgcgttcggcctgtccggtggccag
cagcagcgactggtgattgcgcgggcgatcgcgatcgaacccgaggtgatcctgctcgac
gagccgacctcggcgctggacccgatctcgaccgccaagatcgaggaactggtcgaggaa
ctgaagcagcagtacacgatcatgatcgtgacccacaacatgcagcaggcggcgcgcgtc
tccgactacaccgcctacatgtacctgggcgaactggtcgagtacgcggacaccatgcat
ctgttcacgaacccgagccagaaggcgaccgaggactacatcaccggtcgctacggctga

DBGET integrated database retrieval system