KEGG   Thioalkalivibrio paradoxus: THITH_13955Help
Entry
THITH_13955       CDS       T03590                                 

Definition
(GenBank) hypothetical protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
tti  Thioalkalivibrio paradoxus
Pathway
tti02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:tti00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    THITH_13955
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tti02000]
    THITH_13955
Transporters [BR:tti02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    THITH_13955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 ABC_membrane RsgA_GTPase AAA_16 AAA_22 SMC_N NACHT AAA_33 MMR_HSR1 Bac_DnaA AAA_23 NB-ARC ATPase_2
Motif
Other DBs
NCBI-ProteinID: AHF00255
UniProt: W0DNU6
LinkDB All DBs
Position
3027653..3029326
Genome map
AA seq 557 aa AA seqDB search
MSEWSFLRTVLRGRRAWTGTAYLLLALTWAAGIGLLALSGWFITASALAGAGLLLGLELF
TPSAAIRAAALLRTLARYGERVIGHEAVLRVLADLRIRSFAAIARLPAARQRALRSGDLQ
QRLTADIDTLDAVPLRITGPLVAAVLAIAAAAALAAWLAPWPAALLLVAGAALTLATSLA
AARAGQAQGRELIEQRSRQRVALLDYFGGLAELLAYRRIDRQRALLDRLENEQAARLWRQ
ERVAFVTDQAVQLLVAALTLAMLGLALHWHAQDRIDAPVAVLLTLMTLGLNEVLSTLPGA
LWRVGESLQAAGRLQQLGLTADEKDSAPAPEPASDRPAPAPDGTLEAQDLAIGFDPGRPL
VAGLSFVLQPGCPLVIHGRSGVGKTTLLETLAGEREPLTGELRLAGQRLGDWPEAARYRA
VGYLPQHTSLLDASIGDNLRLGRQDLPDQTLWQALEAVDLATALRREGFGLDYAVGEGGR
RLSGGQARRLALAALLLRDTPVTLLDEPFASLDPGTAARVLKNIAPWFATRRVVIVTHAP
ETLPGSWPRLQIAPPRG
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgagtggtcgttcctccgtaccgtactgcgcggccgccgcgcctggaccggtacc
gcctacctgctgctcgcgctgacctgggccgcggggatcggcctgttggccttgtccggc
tggttcatcaccgcgtcggcattggccggggccggcctgctgctcggactggagttgttc
acgccgtccgcggccatccgtgccgccgcgctgctgcgcacgctggcacgctacggcgag
cgggtgatcgggcacgaggccgtgctgcgcgtgctggccgatctgcgcatacgcagcttc
gccgccatcgcccggcttccagccgcgcgccagcgtgcactgcgcagcggcgatctccag
cagcgcctgaccgccgacatcgacacgctggacgcggtacccctgcgcatcacgggtccg
ctcgttgcggcggtgctcgcaatcgctgccgccgccgcgctggcggcatggctggcgcca
tggccggctgcactgctgctggtcgcaggcgcggcgctgacactggccacgtcgcttgcc
gccgcccgcgccggacaggcacaggggcgcgagctgatcgagcagcgcagtcgccagcgg
gtcgcgctgctcgactacttcggcgggctcgccgaactgctcgcgtaccgccggatcgac
cggcagcgggcgctgctcgaccggctcgagaacgaacaggcggcacgactgtggcgccag
gagcgcgtggcgttcgtgaccgaccaggcggtgcagctgctggtcgcggcactcacgctg
gcgatgctcgggctggcgctgcactggcacgcgcaggaccgcatcgatgcgccggtggcg
gtgctgctgacgctgatgacgctgggcctgaacgaagtgctgagcaccttgccaggcgcg
ctgtggcgcgtcggcgagagcctgcaggccgcgggccgcctgcagcagctcggactcacc
gccgacgagaaggattctgcgcccgcgccggaacctgcaagcgatcggccggcaccagcc
cccgatggcacactcgaggcacaggacctggcgatcggcttcgaccccggccggccgctg
gtggccggcctgtccttcgtgctccagcccggatgcccactggtgatccacggccgcagc
ggcgtcggcaagaccacgctgctggagacgctggccggcgaacgggagccgctgaccggc
gagttacgactcgcgggacagcggctcggcgactggccggaagccgcccgctaccgcgcc
gtgggctacctgccgcagcacacgtcgctgctggacgcgagcatcggtgacaacctgcgc
ctcggccggcaggatcttccggatcaaaccctctggcaggcgctcgaggcggtcgatctc
gccacggcccttcggcgcgagggtttcgggctggactatgcggttggcgagggcggacgc
cggctgtcgggaggccaggcccggcgcctggcgctggctgccctgctgctgcgcgacacg
ccggtgacgctgctggacgaaccgtttgcaagcctcgaccccggcaccgcagcgcgcgtg
ctgaaaaacatcgcgccctggttcgcaacccggcgggtagtgatcgtcacccatgccccc
gagacgctgcccggcagttggccccggctgcagatcgcgccgccgcgcggctga

DBGET integrated database retrieval system