KEGG   Thermus thermophilus HB8: TTHA0536Help
Entry
TTHA0536          CDS       T00220                                 

Definition
(RefSeq) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00020  Citrate cycle (TCA cycle)
ttj00270  Cysteine and methionine metabolism
ttj00620  Pyruvate metabolism
ttj00630  Glyoxylate and dicarboxylate metabolism
ttj00680  Methane metabolism
ttj00710  Carbon fixation in photosynthetic organisms
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01120  Microbial metabolism in diverse environments
ttj01130  Biosynthesis of antibiotics
ttj01200  Carbon metabolism
Module
ttj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ttj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ttj_M00012  Glyoxylate cycle
ttj_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TTHA0536
   00620 Pyruvate metabolism
    TTHA0536
   00630 Glyoxylate and dicarboxylate metabolism
    TTHA0536
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TTHA0536
   00680 Methane metabolism
    TTHA0536
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    TTHA0536
Enzymes [BR:ttj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     TTHA0536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N DUF4885 Glyco_hydro_3_C
Motif
Other DBs
NCBI-GeneID: 3168364
NCBI-ProteinID: YP_143802
UniProt: Q5SKV7
LinkDB All DBs
Structure
PDB: 

Position
complement(498584..499567)
Genome map
AA seq 327 aa AA seqDB search
MKAPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDC
AFPLLAGLEATDDPKVAFKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVA
KKDVKVLVVGNPANTNALIAYKNAPGLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRR
MTVWGNHSSTMFPDLFHAEVDGRPALELVDMEWYEKVFIPTVAQRGAAIIQARGASSAAS
AANAAIEHIRDWALGTPEGDWVSMAVPSQGEYGIPEGIVYSFPVTAKDGAYRVVEGLEIN
EFARKRMEITAQELLDEMEQVKALGLI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggcacccgtacgcgtggcggttaccggagccgcgggacagatcggctacagcctc
ctcttccgcatcgccgcgggggagatgctgggcaaggaccagccggtgatcctccagctt
ttggagatcccccaggccatgaaggccctggagggcgtggtcatggagctggaggactgc
gccttccccctgcttgcgggcctcgaggccaccgacgaccccaaggtggccttcaaggac
gccgactacgccctcctggtgggggcggccccccgcaaggcggggatggagcgccgggac
cttctgcaggtgaacggcaagatcttcaccgagcagggccgggccctggccgaggtggcc
aagaaggacgtcaaggtgctggtggtgggcaaccccgccaacaccaacgccctcatcgcc
tacaagaacgcccccggcctcaacccccggaacttcaccgccatgacccggctggaccac
aaccgggccaaggcccagctcgccaagaagaccgggacgggcgtggaccgcatccgccgc
atgacggtgtggggcaaccactcctccaccatgttccccgacctcttccacgccgaggtg
gacggcaggcccgccctggagctcgtggacatggagtggtacgagaaggtcttcatcccc
accgtggcccagcggggggcggccatcatccaggcccggggggccagcagcgccgccagc
gccgcgaacgccgccatagagcatatccgcgactgggccctgggcaccccggagggggac
tgggtctccatggccgtcccctcccaaggggagtacggcatccccgaaggcatcgtctac
tccttcccggtgacagccaaggacggagcgtaccgggtcgtggaaggcctggagatcaac
gagttcgcccgcaagcgcatggagatcacggcccaggaactcctggacgagatggagcag
gtgaaggccctgggcctcatctga

DBGET integrated database retrieval system