KEGG   Thermus thermophilus HB8: TTHA0626Help
Entry
TTHA0626          CDS       T00220                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00620  Pyruvate metabolism
ttj00680  Methane metabolism
ttj00710  Carbon fixation in photosynthetic organisms
ttj01100  Metabolic pathways
ttj01120  Microbial metabolism in diverse environments
ttj01200  Carbon metabolism
Module
ttj_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TTHA0626
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TTHA0626
   00680 Methane metabolism
    TTHA0626
Enzymes [BR:ttj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TTHA0626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF4350
Motif
Other DBs
NCBI-GeneID: 3169755
NCBI-ProteinID: YP_143892
UniProt: Q5SKL7
LinkDB All DBs
Position
596552..599128
Genome map
AA seq 858 aa AA seqDB search
MSQDPFALLKAEVDLLGRLLGEAIRTLSGERFFALVEEVRALAKARRQGDEAAGEALLAR
VEGLSTEEAEALVRAFTHYFHLVNLAEERHRVRVNRLRAQAETLESPRPEGFLALAKALK
ERGLSLEEAEAHLNRLELLLTFTAHPTETRRRTLRHHLEALQRELEAGDRERLAARVALL
YGTEEVRKARPTVEDEIKGGLYYLPTTLWEAVPRVVAGLEAALERVYGRRPRLKSPVRFR
SWIGGDRDGNPFVTPEVTAFAGRYAREVARRRFLEALEDLVRDLSLAEARVPVPREVRER
GEGVERFMGEPYRRYFAALYRALEREEATTEGLLAALKAAERGLREVGLGRVAEAFLDPL
EARLSAFGLELAPLDLREESGRLLEAAAELLRVGGVHPDFLALPQEERERLLTEELKTAR
PLLPVGEAPEGEALRVALGALKAWRDKGAHVVSMTHHPEDLLAVFLLAREVGLYRPGRPL
PFDVVPLFETLEDLRRAPGVLRRLLENPVFLAHARGRGGVEVMIGYSDSNKDAGFLMANL
ALYEAQEALSRVGEEVGLPVYFFHGRGTSTARGGGPAGRAIASLPPRSVGRRIRLTEQGE
ALADRYSHPDLAVRHLEQMLYHFALAALGPGQEPEARWREALAQAAEESTRRYRALLQEE
GFFDFFEAFTPIREIGELPIASRPVYRRGRVRDIRDLRAIPWVMAWTQVRVLLPGWYGLS
ALEELPLDLLREMYRGWPFFASTLEAAAMALAKADMGVARLYLRLVPEPLRFFYRRLAEE
HARTVALLEAVFQAPLLHNQRTLERQIRLRNPYVDPINIVQVELLRRYRAPGGKEDEALR
RALLLSILGVAAGLRNAG
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
gtgagccaggaccccttcgccctccttaaggccgaggtggacctcctcggccgcctcctc
ggggaggccatccggaccctctccggggagcgcttcttcgccctggtggaggaggtgcgg
gccctcgccaaggcccgccgccagggggacgaggcggcgggagaggcgcttctggcccgg
gtggaggggctttccaccgaggaggccgaggccttggtgcgggccttcacccactacttc
cacctggtgaacctggcggaggagcggcaccgggtgcgggtgaaccgcctaagggcccag
gccgagaccctggaaagccccaggcccgagggcttcctggccctggccaaggcgcttaag
gagcgggggctttccctggaggaggccgaggcccacctgaaccgcctggagctcctcctc
accttcaccgcccaccccacggagacccggcgccgcaccctgcgccaccacctcgaggcc
ctgcagagggagctggaggcgggggatagggaaaggctcgccgcccgggtggccctcctc
tacggcacggaggaggtgcgcaaggcccgccccacggtggaggacgagatcaaggggggg
ctttactacctgcccaccaccctgtgggaggccgtgccccgggtggtggcgggcctcgag
gccgccctggagagggtctacgggcgaaggccccgcctgaaaagccccgtgcgctttagg
agctggatcggcggcgaccgggacggcaaccccttcgtcacccccgaggtcaccgccttc
gccgggcgctacgcccgggaggtggcccggaggcggtttctggaggccctcgaggacctc
gtgcgcgacctctccctggccgaggcccgcgttcccgtcccccgggaggtgcgggagagg
ggagagggggtggagcgcttcatgggggagccctaccgccgctacttcgccgccctgtac
cgggccttggagcgggaggaggccaccacggaagggcttctcgccgccctgaaggcggcg
gagcgggggcttagggaggtggggcttggccgggtggcggaggccttcttggaccccttg
gaggcccgcctttccgccttcggcctggagctcgcccccctggacctcagggaggagtcg
gggaggctcctcgaggccgcggccgagctcctccgggtgggcggggtccaccccgacttc
ctcgcccttccccaggaggagcgggagcgcctcctcaccgaggagctcaagaccgcccgc
cccctcctccccgtgggggaggccccggagggggaggccctaagggtggccctgggggcc
ctgaaggcctggcgggacaagggggcccacgtggtctccatgacccatcacccggaggac
ctcctcgccgtcttcctcctcgcccgggaggtggggctctaccgccccggccggcccctg
ccctttgacgtggtccccctctttgagaccctggaggacctgaggcgggcccccggggtg
ctccgccgccttttggagaaccccgtcttcctggcccacgcccgggggcggggcggggtg
gaggtgatgatcggctactccgactccaacaaggacgcgggcttcctcatggccaacctc
gccctctacgaggcccaggaggccttaagccgggtgggggaggaggtggggcttcccgtc
tacttcttccacggccgggggacctccacggcgaggggtgggggccccgcgggccgggcc
atcgcgagcctcccgccccggagcgtggggcggaggatccgcctcacggagcagggggag
gccctggcggaccggtacagccaccccgacctcgccgtgcgccacctggagcagatgctg
taccacttcgccctggcggccctgggccccggccaggagcccgaggcgcgctggcgggag
gccctggcccaggcggcggaggagagcacccgccgctaccgcgccctcctccaggaggag
gggttctttgacttctttgaggccttcacccccatccgggagatcggggagcttcccatc
gccagccgccccgtgtaccgccgggggcgggtgcgggacatccgggacctccgggccatc
ccttgggtcatggcctggacccaggtccgggttctcctgcccggctggtacggcctctcc
gctctggaagagcttcctttggaccttctccgggagatgtaccggggctggcccttcttc
gcctccaccctggaggccgcggccatggccctcgccaaggcggatatgggggtggcccgc
ctctatctgcgcctggtccccgagcccctgcggttcttctaccgccggctcgccgaggaa
cacgcccgcaccgtggcccttttggaggccgtcttccaggcccccctcctccacaaccag
aggaccctggagcggcagatccggctccgtaacccctacgtggaccccatcaacatcgtc
caggtggagcttctccgccgctatcgggctcccgggggcaaggaggacgaggccctgagg
cgggcccttctcctctccatcctgggcgtggcggcgggcctcaggaacgcgggttga

DBGET integrated database retrieval system