KEGG   Thermus thermophilus HB8: TTHA1385Help
Entry
TTHA1385          CDS       T00220                                 

Definition
(RefSeq) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01130  Biosynthesis of antibiotics
ttj01230  Biosynthesis of amino acids
Module
ttj_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TTHA1385
Enzymes [BR:ttj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     TTHA1385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_16 CoaE AAA_22 AAA_33
Motif
Other DBs
NCBI-GeneID: 3169123
NCBI-ProteinID: YP_144651
UniProt: Q5SII4
LinkDB All DBs
Position
1322023..1322577
Genome map
AA seq 184 aa AA seqDB search
MARLEVPRPATFVTLTGFMGVGKSRIGRELARALMLHFIDLDRYIERRTGISIPDIFRHL
GEEAFRRMEKEAVRELVGKDYLVLSLGGGTFMDPESQKALLGRGPVVALWASPETILERA
MRKPGERPLLQVENPLERIRTLLEARAPVYRKAHIHVSTDGRRVEEVVEEIVEKLWRHAE
ARGA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcctcgaggttccccgtcccgccaccttcgtcaccctcaccgggttcatgggg
gtggggaaaagccgcatcgggcgggagctcgcccgggcgctcatgctccacttcattgac
ctggaccgctacattgagcggcgcaccgggatctccatccccgacatcttccgccacctc
ggggaggaggccttccgcaggatggagaaggaagcggtgcgggagctcgtgggaaaggac
tacctggtcctctccctgggcgggggaaccttcatggacccggaaagccaaaaggccctc
ctcggccgcgggcccgtggtggccctatgggcgagccccgagaccatcctggaaagggcc
atgcgcaagcccggggaaaggcccctcctccaggtggaaaaccccctggagaggatccgg
accctcctcgaggcccgggcccccgtctaccgcaaggcccacatccacgtctccaccgac
gggcgtcgcgtggaggaagtggtggaggagatcgtagagaagctctggcgccatgcagag
gctagaggtgcgtga

DBGET integrated database retrieval system