KEGG   Thermosulfidibacter takaii: TST_1722Help
Entry
TST_1722          CDS       T04192                                 

Gene name
hisIE
Definition
(GenBank) phosphoribosyl-ATP pyrophosphohydrolase/phosphoribosyl-AMP cyclohydrolase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
ttk  Thermosulfidibacter takaii
Pathway
ttk00340  Histidine metabolism
ttk01100  Metabolic pathways
ttk01110  Biosynthesis of secondary metabolites
ttk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ttk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    TST_1722 (hisIE)
Enzymes [BR:ttk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     TST_1722 (hisIE)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     TST_1722 (hisIE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG LisH_TPL
Motif
Other DBs
NCBI-ProteinID: BAT72506
UniProt: A0A0S3QW09
LinkDB All DBs
Position
complement(1751230..1751883)
Genome map
AA seq 217 aa AA seqDB search
MDLAWDDKGMIPAIVQDADTGEVLMLAYMNEEALNRTLATKKAHFYSRKRQRIWMKGEES
GNTLEVVDVVVDCDSDAVLLKVKPKGPACHTGHKSCFFKNLEGEELEPPVEEDLYGGGCS
ILERVYEVILERKANPEREDSYTALLFRKGLDKILKKVGEEATEVVIGCKNENKDEIVYE
VADLFYHTLVALAYFDIAPHQVYEELRRRFGKSGLRK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatttggcgtgggatgataaggggatgatccctgctattgtacaggatgccgataca
ggagaagttttgatgctggcttacatgaacgaagaagcactgaacaggacattggctacg
aaaaaagcccatttttactctaggaaaaggcagcgcatatggatgaagggtgaggaatcg
ggaaacaccttagaggttgttgatgtagtggtggattgcgactcagatgcggtgcttttg
aaggtcaagcctaaggggcctgcctgtcatacaggacataagagctgctttttcaaaaat
cttgagggcgaggagctggagccgccggtagaagaagacctttacggtggtggatgttcc
atactggagagggtatacgaggtgatccttgagagaaaggcaaatcctgagagggaagac
tcctatactgcgcttttgttcagaaagggacttgataagatattgaagaaggtgggtgaa
gaagcaaccgaggtggttatcggctgtaagaatgagaataaagatgagattgtctatgag
gtggccgacctattttatcatacccttgtcgcccttgcctattttgacatagctccccat
caagtatatgaagagttgcgcagaagatttggtaagtcggggttgagaaagtga

DBGET integrated database retrieval system