KEGG   Thermus thermophilus JL-18: TtJL18_1445Help
Entry
TtJL18_1445       CDS       T02009                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ttl  Thermus thermophilus JL-18
Pathway
ttl00620  Pyruvate metabolism
ttl00680  Methane metabolism
ttl00710  Carbon fixation in photosynthetic organisms
ttl01100  Metabolic pathways
ttl01120  Microbial metabolism in diverse environments
ttl01200  Carbon metabolism
Module
ttl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ttl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TtJL18_1445
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TtJL18_1445
   00680 Methane metabolism
    TtJL18_1445
Enzymes [BR:ttl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TtJL18_1445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF4350
Motif
Other DBs
NCBI-ProteinID: AFH39325
UniProt: H9ZSL5
LinkDB All DBs
Position
complement(1335011..1337587)
Genome map
AA seq 858 aa AA seqDB search
MSQDPFALLKAEVDLLGRLLGEAIWTLSGERFFALVEEVRALAKARRQGDEAAGEALLAR
VEGLSTEEAEALVRAFTHYFHLVNLAEERHRVRVNRLRAQAETLESPRPEGFLALAKALK
ERGLSLEEAEAHLNRLELLLTFTAHPTETRRRTLRHHLEALQRELEAGERERLAARVALL
YGTEEVRKARPTVEDEIKGGLYYLPTTLWEAVPRVVAGLEAALERVYGRRPRLKSPVRFR
SWIGGDRDGNPFVTPEVTAFAGRYAREVARRRFLEALEDLVRDLSLAETRIPVPREVRER
GEGVERFPGEPYRRYFAALYRALEREEATTEGLLAALKAAERGLREVGLGRVAEAFLDPL
EARLSAFGLELAPLDLREESGRLLEAAAELLRVGGVHPDFLALPQEERERLLTEELKTAR
PLLPVGEAPKGEALRVALGALRVWRDKGAHVVSMTHHPADLLAVFLLAREVGLYRPGRPL
PFDVVPLFETLEDLKRAPEVVRRLLKNPVFRAHAEGRGGVEVMIGYSDSNKDAGFLMANL
ALYEAQEALSRVGEEVGLPVYFFHGRGTSTARGGGPAGRAIASLPPRSVGRRIRLTEQGE
ALADRYSHPDLAVRHLEQMLYHFALAALDPGQEPEARWREALAQAAEESTRRYRALLQEE
GFFDFFEAFTPIREIGELPIASRPVYRRGRVRDIRDLRAIPWVMAWTQVRVLLPGWYGLS
ALEELPLDLLREMYRGWPFFASTLEAAAMALAKADMGVARLYLRLVPEPLRFFYRRLAEE
HARTVALLEAIFQAPLLHNQRTLERQIRLRNPYVDPINIVQVELLRRYRAPGGKEDEALR
RALLLSILGVAAGLRNAG
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
gtgagccaggaccccttcgccctcctcaaggccgaggtggacctcctcggccgcctcctc
ggggaggccatctggaccctctccggggagcgcttcttcgccctggtggaggaggtgcgg
gccctcgccaaggcccgccgccagggggacgaggcggcgggagaggcgcttctggcccgg
gtggaggggctttccaccgaggaggccgaggccttggtgcgggccttcacccactacttc
cacctggtgaacctggcggaggagcggcaccgggtgcgggtgaaccgcctaagggcccag
gccgagactctggaaagccccaggcccgagggtttcctggccctggccaaggcgcttaag
gagcgggggctttccctggaggaggccgaggcccacctgaaccgcctggagctcctcctc
accttcaccgcccaccccacggagacccggcgccgcaccctgcgccaccacctcgaggcc
ctgcagcgagaactggaggcgggagagcgggaaaggctcgccgcccgggtggccctcctc
tacgggacggaggaggtgcgcaaggcccgccccacggtggaggacgagatcaaggggggg
ctttactacctgcccaccaccctgtgggaggccgtgccccgggtggtggcgggcctcgag
gccgccctggagagggtctacgggcgaaggccccgcctgaaaagccccgtgcgcttcagg
agctggatcggcggcgaccgggacggcaaccccttcgtcacccccgaggtcaccgccttc
gccgggcgctacgcccgagaggtggcccggaggcggtttctggaggccctcgaggacctc
gtgcgcgacctctccctggccgagacccgcatccccgtcccccgggaggtgcgggagagg
ggagagggggtggagcgctttcccggggagccctaccgccgctacttcgccgccctgtac
cgggccttagagcgggaggaggccaccacggaagggcttctcgccgccctcaaggcggcg
gagcgggggcttagggaggtggggcttggccgggtggcggaggccttcttggaccccttg
gaggcccgcctttccgccttcggcctggagctcgcccccctggacctcagggaggagtcg
gggaggctcctcgaggccgcggccgagctcctccgggtgggcggggtccaccccgacttc
ctcgcccttccccaggaggagcgggagcgcctcctcaccgaggagctcaagaccgcccgc
cccctcctccccgtgggggaggcccctaagggggaggccctgagggtggccctgggggcc
ctaagggtctggcgggacaagggggcccatgtggtctccatgacccaccatcccgccgac
cttctcgccgtcttcctcctcgcccgggaggtggggctttaccgtcccggccggccccta
ccctttgacgtggtccccctctttgagaccctggaggacctgaagcgggcccccgaggtt
gtaaggcgccttctaaagaaccctgtcttccgggcccacgccgaggggcggggcggggtg
gaggtgatgatcggctactccgactccaacaaggacgcgggcttcctcatggccaacctc
gccctctacgaggcccaggaggccttaagccgggtgggggaggaggtggggcttcccgtc
tacttcttccacggccgggggacctccacggcgaggggtgggggccccgcgggccgggcc
atcgcgagcctcccgccccggagcgtggggcggaggatccgcctcacggagcagggggag
gccctggcggaccggtacagccaccccgacctcgccgtgcgccacctggagcagatgctg
taccacttcgccttggcggccctggaccccggccaggagcccgaggcgcgctggcgggag
gccctggcccaggcggcggaggagagcacccgccgctaccgtgccctcctccaggaggag
gggttctttgacttctttgaggccttcacccccatccgggagatcggggagcttcccatc
gccagccgccccgtgtaccgccgggggcgggtgcgggacatccgggacctccgggccatc
ccttgggtcatggcctggacccaggtccgggttctcctgcccggctggtacggcctctcc
gctctggaagagcttcctttggaccttctccgggagatgtaccggggctggcccttcttc
gcctccaccctggaggccgcggccatggccctcgccaaggcggatatgggggtggcccgc
ctctatctgcgcctggtccccgagcccctgcggttcttctaccgccggctcgccgaggaa
cacgcccgtaccgtggcccttttggaggctatcttccaggcccccctcctccacaaccag
aggaccctggagcggcagatccggctccgtaacccctacgtggaccccatcaacatcgtc
caggtggagcttctccgtcgttaccgggcccccgggggcaaggaggacgaggccctgagg
cgggcccttctcctctccatcctgggcgtggcggcgggcctcaggaacgcgggttga

DBGET integrated database retrieval system