KEGG   Thermus thermophilus JL-18: TtJL18_1540Help
Entry
TtJL18_1540       CDS       T02009                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
ttl  Thermus thermophilus JL-18
Pathway
ttl00020  Citrate cycle (TCA cycle)
ttl00270  Cysteine and methionine metabolism
ttl00620  Pyruvate metabolism
ttl00630  Glyoxylate and dicarboxylate metabolism
ttl00680  Methane metabolism
ttl00710  Carbon fixation in photosynthetic organisms
ttl01100  Metabolic pathways
ttl01110  Biosynthesis of secondary metabolites
ttl01120  Microbial metabolism in diverse environments
ttl01130  Biosynthesis of antibiotics
ttl01200  Carbon metabolism
Module
ttl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ttl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ttl_M00012  Glyoxylate cycle
ttl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TtJL18_1540
   00620 Pyruvate metabolism
    TtJL18_1540
   00630 Glyoxylate and dicarboxylate metabolism
    TtJL18_1540
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TtJL18_1540
   00680 Methane metabolism
    TtJL18_1540
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    TtJL18_1540
Enzymes [BR:ttl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     TtJL18_1540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: AFH39418
UniProt: H9ZSV8
LinkDB All DBs
Structure
PDB: 

Position
1436132..1437115
Genome map
AA seq 327 aa AA seqDB search
MKAPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDC
AFPLLAGLEATDDPKVAFKDADYALLVGAAPRKAGMERRDLLEMNGKIFTEQGRALAEVA
KKDVKVLVVGNPANTNALIAYKNAPGLNPRNFTAMTRLDHNRAKAQLAKKTGVPVDRIRR
MTVWGNHSSTMFPDLFHAEVDGRPALELVDMEWYEKVFIPTVAQRGAAIIQARGASSAAS
AANAAIEHIRDWALGTPEGDWVSMAVPSQGEYGIPEGIVYSFPVTAKDGAYQVVEGLEIN
EFARKRMELTAQELLDEMEQVKALGLI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggcacccgtacgcgtggcggttaccggagccgcgggacagatcggctacagcctc
ctcttccgcatcgccgcgggggagatgctgggcaaggaccagccggtgatcctccagctt
ttggagatcccccaggccatgaaggccctggagggcgtggtcatggagctggaggactgc
gccttccccctgcttgcgggcctcgaggccaccgacgaccccaaggtggccttcaaggac
gccgactacgccctcctggtgggggcggccccccgcaaggcggggatggaacggcgggac
ctcctggagatgaacggcaagatcttcaccgagcagggccgggccctggccgaggtggcc
aagaaggacgtcaaggtgctggtggtgggcaaccccgccaacaccaacgccctcatcgcc
tacaagaacgcccccggcctcaacccccggaacttcaccgccatgacccggctggaccac
aaccgggccaaggcccagctcgccaagaagaccggggtccccgtggaccgcatccgccgc
atgacggtgtggggcaaccactcctccaccatgttccccgacctcttccacgccgaggtg
gacggcaggcccgccctggagctcgtggacatggagtggtacgagaaggtcttcatcccc
accgtggcccagcggggggcggccatcatccaggcccggggggccagtagcgccgccagc
gccgcgaacgccgccatagagcacatccgcgactgggccctgggcaccccggagggggac
tgggtttccatggccgtcccctcccaaggagagtacggcatccccgagggcatcgtctac
tccttcccggtgacggccaaggacggagcgtaccaggtcgtggaaggcctggagatcaac
gagttcgcccgcaagcgcatggagctcacggcccaggaactcctggacgagatggagcag
gtgaaggccctgggcctcatctga

DBGET integrated database retrieval system