KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_0416Help
Entry
Tthe_0416         CDS       T01299                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Brite
KEGG Orthology (KO) [BR:ttm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ttm03012]
    Tthe_0416
   03029 Mitochondrial biogenesis [BR:ttm03029]
    Tthe_0416
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ttm04147]
    Tthe_0416
Translation factors [BR:ttm03012]
 Eukaryotic Type
  Elongation factors
   Tthe_0416
 Prokaryotic Type
   Tthe_0416
Mitochondrial biogenesis [BR:ttm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Tthe_0416
Exosome [BR:ttm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Tthe_0416
  Exosomal proteins of breast cancer cells
   Tthe_0416
  Exosomal proteins of colorectal cancer cells
   Tthe_0416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase Peptidase_U32_C
Motif
Other DBs
NCBI-ProteinID: ADL67985
UniProt: D9TRT8
LinkDB All DBs
Position
412274..413476
Genome map
AA seq 400 aa AA seqDB search
MAKQKFERKKPHANIGTIGHVDHGKTTLTSAITIVLSKQGMAQATAYDEIDKAPEEKARG
ITINTMHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKADMVDDEELIELVEMEVRELLNEYEFPGDDTPIVVGSALKAME
CGCGQRDCQWCGKIWELMDVVDSYIPTPERDVDKPFLMPVEDVFTITGRGTVATGRVERG
KLKVGDEVEIIGLSDESKKTVVTGVEMFRKTLDEAEAGDNIGVLLRGVTRDEVERGQVLA
KPGSVKPHTKFEGQVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGVIELPEGVEMVMPG
DHVTMTIELITPIAMEEGLKFAIREGGHTVGAGVVSKILS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcaaaaatttgaaagaaagaaaccccatgcaaacataggaacgatagggcac
gtagaccatggcaaaacgacgttaacatcagcaataacaatagtattgtcaaagcaaggg
atggcacaagccacagcatatgatgaaatagacaaagcaccagaagagaaagcaagagga
ataacaataaacacaatgcacgtagaatacgagacagagaaaaggcactatgcgcatgta
gactgtccagggcacgcagactacgtaaagaacatgataacaggagcagcgcagatggac
ggagcgatactagtagtatcagcagcagatggtccaatgccgcagacaagagagcacatc
ctgttagcaaggcaggtaggagtaccatacattgtagtattcctaaacaaagcagacatg
gtagatgatgaagaattaatcgaactagtagagatggaagtaagagaactattaaacgaa
tatgaattcccaggagacgacacaccgatagtagtaggttcagcattaaaagcaatggaa
tgcggatgtggacaaagagactgtcagtggtgcggcaagatatgggaattaatggatgta
gttgacagttatataccgacaccagaaagagacgtagacaagccattcctgatgccagta
gaagatgtattcacaataacaggaagagggacagtagcaacaggaagagtagagagaggc
aaattaaaagtaggagacgaagtagagataataggcttatcagacgaaagcaagaagaca
gtagtaacaggagtagagatgttcaggaagacattggacgaagcagaagcaggagataac
ataggagtactgttaagaggagtaacaagagatgaagtagagagagggcaagtactggcg
aaaccagggtcagtaaaaccgcacacgaaatttgaaggacaagtatacgtgttaacaaag
gaagaaggcggaagacatacaccgttcttcaatggatacagaccacagttctacttcagg
acaacagacgtaacaggagtaatagaattaccagagggcgtagagatggtaatgcccgga
gaccatgtaacgatgacaatagaattaataacaccgatagcaatggaagaaggattaaaa
tttgctataagggaaggcggacacacagtaggagccggtgttgtttccaagattctgtca
taa

DBGET integrated database retrieval system