KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_0537Help
Entry
Tthe_0537         CDS       T01299                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
ttm00473  D-Alanine metabolism
ttm01100  Metabolic pathways
ttm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ttm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Tthe_0537
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Tthe_0537
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ttm01011]
    Tthe_0537
Enzymes [BR:ttm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Tthe_0537
Peptidoglycan biosynthesis and degradation proteins [BR:ttm01011]
 Precursor biosynthesis
  Racemase
   Tthe_0537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADL68100
UniProt: D9TST5
LinkDB All DBs
Position
523645..524811
Genome map
AA seq 388 aa AA seqDB search
MLNLYRPTWAEVNLNNIIHNYKEIRKITDKKAGIMAVVKANAYGHGSYEISKELIKCGVD
YLAVATIDEALELREHGISKPILVLGYTPSKFADVIVKYDITQTAFELGYVKEISKEAIK
QGKDAKIHVKIDTGMGRIGYNDMNKAYEEIVAMTSLKGIYIEGIFSHFSSSDERDKEYTM
RQFKIFNDLTDRLKRSGIDIPIRHIANSAAILDLPETHLDMVRPGIILYGSYPSEEVDKK
ISLKCTISLRSKIVYIKDVPEGEYISYNRTYKTSRKSRIATLPIGYADGLNRLLSNNHSV
IIKGKYAPIVGKICMDQCMVDVTSIEGVKEGDVATIMGESDGKIVSADEIANKLKTISYE
VYCGISRRVPRIYIFNGEITKVENYLKC
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatttatataggccaacatgggcagaagtcaatcttaataatataattcacaac
tacaaagagatcagaaaaataacagataaaaaggctgggataatggctgttgtaaaagca
aatgcgtatggtcatggatcatatgagatatcgaaagaattgattaaatgcggtgttgat
tatctcgccgtagctacgattgatgaggcgctggaattgagagagcacggaatcagtaaa
cccatactagtattgggatacacaccgtcgaagtttgcagatgtaattgtaaagtatgat
attacacagactgcatttgagctaggctatgtgaaggaaatttcaaaagaagccataaag
caagggaaagatgcgaaaattcacgtaaaaattgataccggcatgggacgcattggctac
aacgatatgaataaagcatatgaggaaattgttgccatgacttcgctgaaaggaatttat
atagaaggcatattcagccacttttcgtcatccgatgaaagggataaagaatacactatg
cggcaatttaaaatatttaatgatcttacggatcgattaaaaagaagtggaatagatatc
ccaataaggcatattgcaaacagtgctgcaatattagatttgcctgaaacgcatcttgac
atggtaaggcctggcattatactgtatggaagttatccgtcagaagaagttgataaaaag
atcagcttaaaatgcactatatcactaaggtctaaaattgtatatataaaagatgttcca
gagggtgagtatataagctacaataggacatacaagacaagcagaaaaagccgtatagcc
acattgcctattggttatgcagatggactaaatagactattgtcaaataatcacagtgtc
ataataaaaggtaaatatgcgcctattgtggggaagatatgcatggatcaatgtatggtg
gacgtaacgtcaattgaaggcgtaaaagaaggcgatgttgccacgattatgggtgaatca
gacggcaaaatcgtaagtgcagatgaaatagcaaataaattaaaaactatttcttatgaa
gtatattgtggaatatccagaagggtaccaagaatatatatatttaatggagagataaca
aaagtagaaaattatttaaaatgttaa

DBGET integrated database retrieval system