KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_1088Help
Entry
Tthe_1088         CDS       T01299                                 

Definition
(GenBank) Manganese/iron superoxide dismutase-like protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Brite
Enzymes [BR:ttm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Tthe_1088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ADL68609
UniProt: D9TNK3
LinkDB All DBs
Position
complement(1115148..1115744)
Genome map
AA seq 198 aa AA seqDB search
MKRLIPKKYNLTLNGISERTLREHYKLYEGYVSKTNEIWNKLITSDRVKANATYSEYREL
KLEETYALDGVKLHELYFENLGGAGGPATGIIASMITCDFGSYDNWINDFKACAISSRGW
TALCFDPIDLRLHNYLQDLHNHGLVTRTIPLLIIDTYEHAYFIDYGTDKKGYIDAFMNNV
KWSEVNRRVIQWIDMKKF
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaggctcataccaaaaaaatataatttgaccttaaatggtatatctgaaaggact
ctaagagaacattataaactttacgaaggatatgtaagtaagacaaacgaaatatggaac
aaactaatcacatctgatcgagttaaggcaaacgccacgtacagcgaatacagagaatta
aagcttgaagaaacatatgcactagatggggttaaacttcatgaactttactttgaaaac
ctcggcggagcaggtggtcctgcaactgggataatcgcctccatgataacttgtgatttt
ggttcttatgataactggattaatgactttaaagcatgtgctatatcttccagaggttgg
acagcactatgttttgatccgattgatttaaggctccacaactacctgcaagacctccac
aaccacggccttgtaaccagaacaattcctcttctcattattgacacttatgagcacgca
tatttcatagattacggaacagataaaaaaggttatattgatgcattcatgaataatgtg
aagtggagtgaagtcaatagaagagtaattcaatggatagacatgaaaaaattttaa

DBGET integrated database retrieval system