KEGG   Thermoproteus tenax: TTX_1107Help
Entry
TTX_1107          CDS       T01641                                 

Gene name
pepC-1
Definition
(GenBank) phosphoenolpyruvate carboxylase 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ttn  Thermoproteus tenax
Pathway
ttn00620  Pyruvate metabolism
ttn00680  Methane metabolism
ttn00720  Carbon fixation pathways in prokaryotes
ttn01100  Metabolic pathways
ttn01120  Microbial metabolism in diverse environments
ttn01200  Carbon metabolism
Module
ttn_M00168  CAM (Crassulacean acid metabolism), dark
ttn_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:ttn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TTX_1107 (pepC-1)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TTX_1107 (pepC-1)
   00680 Methane metabolism
    TTX_1107 (pepC-1)
Enzymes [BR:ttn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TTX_1107 (pepC-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 Mis12
Motif
Other DBs
NCBI-ProteinID: CCC81750
UniProt: G4RJK5
LinkDB All DBs
Position
958521..959894
Genome map
AA seq 457 aa AA seqDB search
MIPRLMCTQHPDTTVKITAGEEVDEALVAYTAYGCEEVMVDYEGKLTPFTQPKEIVMRAL
AAGVKLGEKFFITPRLPNPKLEEFDRAMLSLEAAVVANYFSLKYMDTQAVRWVVLPMVED
LDTVLLVRRMLRRKIQAYREETNLEISDIEVIPLIEDAFAQLKFEAFLAEIMRDGRVESF
RLFLGKSDSAVKYGHIASALAIVWVLSRVRRAEQELGIKIHPILGMGTPPFRGAINNPAL
AHLEVIQYAGYHTATIQSAIRYDASFEDYIKVKDSILNACCMDARGVDDVDKLVGEAATS
YKSVVAKYVNALLEVARLVPSTRDRVSWKVYGRQFVAEDRAVNMPRAIVYTSTWYAMGLP
PIFLDSPFIVKLAKEDRLDGLLKSLPTLKKEWEYDSEFFDYDTAAKYIGEELIKSVREAM
DYMGINPRTNGAYAALLRMPRSESNIIAMGKYRKFLG
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgattccgcggctcatgtgcactcaacatcctgacacgaccgtcaagataacggcgggc
gaggaggtagacgaggcccttgtggcctacactgcgtacggatgcgaggaggtcatggtc
gattatgagggcaagctgacgcccttcactcagcccaaggagatcgtcatgagggcgttg
gccgccggcgtgaagttgggcgagaagttcttcatcactcccaggcttccgaaccccaaa
ctggaggagttcgatagggcgatgctgtctcttgaggcggcggtagtggccaactacttc
tcgcttaagtatatggacacccaggcggtgaggtgggtcgtgttgcccatggtggaggac
ctagacacagttctcctggttaggagaatgttgaggaggaaaatacaagcatacagggag
gagacaaacctcgagatctccgacatagaggttataccgctgatcgaggacgccttcgcc
caactcaaatttgaggcgtttctcgccgagataatgagggacgggcgcgtggagagcttc
cgcctgttcttgggcaagtcagactcagctgtgaagtacggacacatagcctcggctctg
gcaatcgtctgggtgttgtccagagtgaggagggccgaacaggagctgggcatcaagata
catcccatcctcggcatgggcactccgcccttcagaggagctataaacaaccctgctctg
gcccacctggaggtgattcaatacgccggctaccacactgccactatccagtcggctata
cgttacgatgcgtccttcgaggactatatcaaggtgaaggactccatactgaacgcctgt
tgcatggacgcgagaggggtcgacgatgtggacaagctcgtgggcgaggcagccacgagc
tacaagtccgtagtagcgaaatatgtgaacgcgctcctcgaggtggcgaggctagtgccc
tccacgagggacagagtcagttggaaggtctacgggagacagttcgtggccgaggataga
gcagtcaatatgcccagagcaatagtctatacctccacttggtacgcgatgggcctcccg
cccatattcttggactcgccctttatagtgaagttggccaaggaggacaggctagacggc
ttgctcaagtcgctccctactctcaagaaggagtgggagtacgactcggagttcttcgac
tacgacactgccgccaaatacatcggagaggaattgataaaaagcgtcagagaggccatg
gactacatgggcataaacccgaggacgaacggagcctacgcggcgcttctgaggatgccc
cggagcgagtccaacataatcgccatgggcaaatacagaaagttcctgggttaa

DBGET integrated database retrieval system